Report for Sequence Feature Glyma.05g212600
Feature Type: gene_model
Chromosome: Gm05
Start: 39412222
stop: 39413348
Source: JGI
Version: Wm82.a2.v1
High confidence: yes
A previous version of this gene model can be found here:
Annotations for Glyma.05g212600
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G46150.1 AT
Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family
JGI N/A IEA
GO:0016020 GO-cc
membrane
EnsemblGenomes N/A IEA
GO:0016021 GO-cc
integral component of membrane
EnsemblGenomes N/A IEA
PF03168 PFAM
Late embryogenesis abundant protein
JGI N/A IEA
Proteins Associated with Glyma.05g212600
Locus Gene Symbol Protein Name
LEA2-25 late embryogenesis abundant 2 gene 25
Expression Patterns of Glyma.05g212600
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Related Legume Genes
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS .
Gene information in GlycineMine developed by LIS .
Related Plant Genes
Gene families from PhyloGenes .
Paralogs of Glyma.05g212600
Paralog Evidence Comments
Glyma.08g019000 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.
Gene model name correspondences to Glyma.05g212600 Gene Call Version Wm82.a2.v1
Corresponding Name Annotation Version Evidence Comments
Glyma05g37320 Wm82.a1.v1.1 IGC As supplied by JGI
Coding sequences of Glyma.05g212600
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma.05g212600.1 sequence-type=CDS polypeptide=Glyma.05g212600.1.p locus=Glyma.05g212600 ID=Glyma.05g212600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTCAGAGCCCTGATCAGCAGATGAAGCCCTTAGCTCCATTCATATCATCAACCCAGTTCAGCAGACAAGAAGATCAGTTTCAAGAGAGAACATCCGAACAGAAAATCATTCGCATAAGAAAGTTCGTGCTGTGCTGCGGTTGTTTCACTGCCCTTGTTGTGATACTCGTGGTCATACTGATAGTCTTGAGCTTCACCGTTTACAATGTCAAAGAACCCGAGGTGAGGATGAATTCGGTTACCCTTCTCAGTGGAACTTTTGCAAACGGTGGTGCCACTAACAACGTTACACTTGTTGCTGATATCTTTGTCAAGAACACAAACGCTTTTACCCTGAGGTTTGGAAGCACCAGCACCATTGTTTACTATGATGGTGTGAGAATAGGTGAGGGTACTTCTCCACCGGGTAAGGCCAAGGCAAGAAGGACCATAAGGGTAAACTCGACCTTGGAGATTATGTCAAAGAAGCTTTTGGAAATCCCAACTTTGAATATTGACCTCAGGGATCAGTTTTTGAATATCAGCAGCTATACAAGGATAGATGGTAAGGTGAAAATACTCAACATATTTCCGAGGAAGGTTGTGGTTGAGATGAATTGTACCATTGGATACAACATCACCACTGGGTCGGTCACAAATGGTGATAATTGTCTTGGAGCCGTTGATATTTAG
Predicted protein sequences of Glyma.05g212600
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma.05g212600.1.p sequence-type=predicted peptide transcript=Glyma.05g212600.1 locus=Glyma.05g212600 ID=Glyma.05g212600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAQSPDQQMKPLAPFISSTQFSRQEDQFQERTSEQKIIRIRKFVLCCGCFTALVVILVVILIVLSFTVYNVKEPEVRMNSVTLLSGTFANGGATNNVTLVADIFVKNTNAFTLRFGSTSTIVYYDGVRIGEGTSPPGKAKARRTIRVNSTLEIMSKKLLEIPTLNIDLRDQFLNISSYTRIDGKVKILNIFPRKVVVEMNCTIGYNITTGSVTNGDNCLGAVDI*