SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.05g203900

Feature Type:gene_model
Chromosome:Gm05
Start:38751047
stop:38751631
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.05g203900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13080.1AT WRKY DNA-binding protein 75 JGI N/AIEA
GO:0006351GO-bp transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated JGI N/AIEA
GO:0005634GO-cc nucleus EnsemblGenomesN/AIEA
GO:0003677GO-mf DNA binding EnsemblGenomesN/AIEA
GO:0003700GO-mf DNA binding transcription factor activity EnsemblGenomesN/AIEA
GO:0003700GO-mf sequence-specific DNA binding transcription factor activity JGI N/AIEA
GO:0043565GO-mf sequence-specific DNA binding EnsemblGenomesN/AIEA
GO:0043565GO-mf sequence-specific DNA binding JGI N/AIEA
PF03106PFAM WRKY DNA -binding domain JGI N/AIEA

Proteins Associated with Glyma.05g203900
LocusGene SymbolProtein Name
WRKY49 WRKY Transcripiton Factor
WRKY WRKY protein

Expression Patterns of Glyma.05g203900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.05g203900 not represented in the dataset
Glyma.05g203900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.05g203900
ParalogEvidenceComments
Glyma.08g011300 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.


Coding sequences of Glyma.05g203900
>Glyma.05g203900.1 sequence-type=CDS polypeptide=Glyma.05g203900.1.p locus=Glyma.05g203900 ID=Glyma.05g203900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGAGAAACATCAAGTGGTGTCCCCTATTTCATCTTCATCATCTGCTTCTCCATCTGATTTTAAACTTGGTGATCATAATTCTAATGCTCATATTAAAAACTCAAAGGCCAAGCCTGAAAGTTACTGCAGATGTTCTTATCGAGGTTGCAATGTGAAGAAACAAATCCAACGCCATTCTAAAGACGAAGAGATTGTGGTAACAACCTACGAAGGGATGCATATTCATCCTGTGCAGAAGTCAACTGAAAGCTTCGAGCATATATTGAGAAACGATCACATATACAGCCTAACTCTGTAA
Predicted protein sequences of Glyma.05g203900
>Glyma.05g203900.1.p sequence-type=predicted peptide transcript=Glyma.05g203900.1 locus=Glyma.05g203900 ID=Glyma.05g203900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MEKHQVVSPISSSSSASPSDFKLGDHNSNAHIKNSKAKPESYCRCSYRGCNVKKQIQRHSKDEEIVVTTYEGMHIHPVQKSTESFEHILRNDHIYSLTL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo