Report for Sequence Feature Glyma.05g202400
| Feature Type: | gene_model |
| Chromosome: | Gm05 |
| Start: | 38597559 |
| stop: | 38598765 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.05g202400
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT5G50810.1 | AT |
TIM8 |
JGI | N/A | IEA |
| KOG3489 |
KOG |
Mitochondrial import inner membrane translocase, subunit TIM8 |
JGI | N/A | IEA |
| PF02953 | Pfam |
Tim10/DDP family zinc finger |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.05g202400 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma05g38370 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.05g202400
>Glyma.05g202400.1 sequence-type=CDS polypeptide=Glyma.05g202400.1.p locus=Glyma.05g202400 id=Glyma.05g202400.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGATTTTTCGCAACATAACTCATCTGAAATGGATCAATTCTACACTCAAGAACGGCAAATAGCCATGGCTAATGAAATGGTGGCAAAGCTGACAAGTACAAGCTGGGACAAATGCCTCACTGGTACACCTGGGGGTAAATTCAGTTCTAGTGAATCTACTTGTCTTTCAAACTGTGCTCATCTTTATATTGAGATGAGCGTCCTTGTCATGAAAAGGTTTCAGAGTATGCGATGA
Predicted protein sequences of Glyma.05g202400
>Glyma.05g202400.1.p sequence-type=predicted peptide transcript=Glyma.05g202400.1 locus=Glyma.05g202400 id=Glyma.05g202400.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MDFSQHNSSEMDQFYTQERQIAMANEMVAKLTSTSWDKCLTGTPGGKFSSSESTCLSNCAHLYIEMSVLVMKRFQSMR*