Report for Sequence Feature Glyma.05g192000
| Feature Type: | gene_model |
| Chromosome: | Gm05 |
| Start: | 37759153 |
| stop: | 37760359 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Gene model name correspondences to Glyma.05g192000 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
Coding sequences of Glyma.05g192000
>Glyma.05g192000.1 sequence-type=CDS polypeptide=Glyma.05g192000.1.p locus=Glyma.05g192000 id=Glyma.05g192000.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGATTTTAAACCCTAGGATTAATCTTGCAATAGTGGGCTCTTCCACGCTAGATTTTTGCCAATCTCCTCTCACTACCGCTCGCCATTGTCGAAGGCGATTTTTCGACAAAGGCGTTTCGGTTTTATTTTTCCTTCTTTCCTTGCCACCTCCGGCGACTTCGTCTTCTTCTTTGACCCGTCACCTCCATGAAGAGGAAATCCAGAACAACCAAAAACAAAGATTTGAGATTGGGAAATCTAGAGGCAAGATCTGGTGCGGCGCTCCCTGA
Predicted protein sequences of Glyma.05g192000
>Glyma.05g192000.1.p sequence-type=predicted peptide transcript=Glyma.05g192000.1 locus=Glyma.05g192000 id=Glyma.05g192000.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MILNPRINLAIVGSSTLDFCQSPLTTARHCRRRFFDKGVSVLFFLLSLPPPATSSSSLTRHLHEEEIQNNQKQRFEIGKSRGKIWCGAP*