|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G10500.1 | AT | chloroplast-localized ISCA-like protein | JGI | N/A | IEA |
| GO:0016226 | GO-bp | iron-sulfur cluster assembly | EnsemblGenomes | N/A | IEA |
| GO:0097428 | GO-bp | protein maturation by iron-sulfur cluster transfer | EnsemblGenomes | N/A | IEA |
| GO:0005759 | GO-cc | mitochondrial matrix | EnsemblGenomes | N/A | IEA |
| GO:0005198 | GO-mf | structural molecule activity | EnsemblGenomes | N/A | IEA |
| GO:0008198 | GO-mf | ferrous iron binding | EnsemblGenomes | N/A | IEA |
| GO:0051536 | GO-mf | iron-sulfur cluster binding | EnsemblGenomes | N/A | IEA |
| GO:0051537 | GO-mf | 2 iron, 2 sulfur cluster binding | EnsemblGenomes | N/A | IEA |
| KOG1120 | KOG | Fe-S cluster biosynthesis protein ISA1 (contains a HesB-like domain) | JGI | N/A | IEA |
| PTHR10072 | Panther | IRON-SULFUR CLUSTER ASSEMBLY PROTEIN | JGI | N/A | IEA |
| PTHR10072:SF31 | Panther | IRON-SULFUR ASSEMBLY PROTEIN ISCA, CHLOROPLASTIC | JGI | N/A | IEA |
| PF01521 | PFAM | Iron-sulphur cluster biosynthesis | JGI | N/A | IEA |
|
Glyma.05g184700 not represented in the dataset |
Glyma.05g184700 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.08g142700 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma05g31820 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.05g184700.1 sequence-type=CDS polypeptide=Glyma.05g184700.1.p locus=Glyma.05g184700 ID=Glyma.05g184700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCTTTCTCTGCAATGACTAGCATGCACTCTCCTCAATTTCTCCGCCTTCCCATCTCCCTTCCCCGTTCTTCACCCTCTGGTCGATTTTCACCGCCAATTCTCAAACGCCCTAAACCACTCTCCATTCGATCAGTTTCAATTCCTGCTGCACCAGCATCAGGGTCTCTGGCCCCTGCAATTTCTGTTACGGATAATGTGCTGAAGCACTTGAATAAGATGAGGTCTGAACGAAATCAAGATTTATGTTTAAGAATAGGTGTCAAACAGGGTGGGTGCTCTGGTATGTCATACACAATGGATTTTGAAGACAGGGTTAATAAAAGGCCAGATGATTCAATCATTGAGTATGAAGGTTTTGAAATTGTTTGTGATCCTAAGAGCCTACTCTTCATATTTGGCATGCAATTAGATTACAGTGATGCTCTGATTGGGGGAGGCTTCTCTTTCAAGAATCCTAACGCGACACAGACTTGTGGATGTGGTAAATCCTTTGCTGCCGAAATTTAG
>Glyma.05g184700.1.p sequence-type=predicted peptide transcript=Glyma.05g184700.1 locus=Glyma.05g184700 ID=Glyma.05g184700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MAFSAMTSMHSPQFLRLPISLPRSSPSGRFSPPILKRPKPLSIRSVSIPAAPASGSLAPAISVTDNVLKHLNKMRSERNQDLCLRIGVKQGGCSGMSYTMDFEDRVNKRPDDSIIEYEGFEIVCDPKSLLFIFGMQLDYSDALIGGGFSFKNPNATQTCGCGKSFAAEI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||