SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.05g178300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.05g178300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.05g178300

Feature Type:gene_model
Chromosome:Gm05
Start:36651081
stop:36654179
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.05g178300
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G10260.1AT RAB GTPase homolog H1E JGI N/AIEA
GO:0006890GO-bp retrograde vesicle-mediated transport, Golgi to ER EnsemblGenomesN/AIEA
GO:0006891GO-bp intra-Golgi vesicle-mediated transport EnsemblGenomesN/AIEA
GO:0007264GO-bp small GTPase mediated signal transduction JGI N/AIEA
GO:0042147GO-bp retrograde transport, endosome to Golgi EnsemblGenomesN/AIEA
GO:0005622GO-cc intracellular JGI N/AIEA
GO:0005634GO-cc nucleus JGI N/AIEA
GO:0005737GO-cc cytoplasm JGI N/AIEA
GO:0005794GO-cc Golgi apparatus EnsemblGenomesN/AIEA
GO:0005829GO-cc cytosol EnsemblGenomesN/AIEA
GO:0003924GO-mf GTPase activity EnsemblGenomesN/AIEA
GO:0003924GO-mf GTPase activity JGI N/AIEA
GO:0005525GO-mf GTP binding EnsemblGenomesN/AIEA
GO:0005525GO-mf GTP binding JGI N/AIEA
KOG0094 KOG GTPase Rab6/YPT6/Ryh1, small G protein superfamily JGI N/AIEA
PTHR24073Panther FAMILY NOT NAMED JGI N/AIEA
PTHR24073:SF256Panther JGI N/AIEA
PF00071PFAM Ras family JGI N/AIEA

Expression Patterns of Glyma.05g178300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.05g178300 not represented in the dataset
Glyma.05g178300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.05g178300
ParalogEvidenceComments
Glyma.08g135400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.05g178300 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma05g31200 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.05g178300
>Glyma.05g178300.1 sequence-type=CDS polypeptide=Glyma.05g178300.1.p locus=Glyma.05g178300 ID=Glyma.05g178300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCGACGGTGTCCCCTCTCGCCAAATACAAGCTCGTTTTCTTGGGCGATCAATCCGTTGGCAAAACCAGCATCATCACCCGCTTCATGTACGACAAATTCGACACCACCTACCAGGCAACTATTGGTATTGACTTTTTGTCAAAAACAATGTACCTTGAAGATAGAACTGTTCGCCTGCAGCTTTGGGATACTGCAGGGCAAGAAAGATTTAGAAGTCTCATTCCAAGCTACATAAGAGATTCTTCTGTTGCGGTTATAGTATATGATGTTGCTAACAGGCAATCATTTCTGAACACTAACAAGTGGGTTGAGGAGGTTCGTACAGAACGTGGCAGTGATGTTATTATTGTATTGGTTGGAAACAAAACTGATCTTGTAGATAAGAGGCAAGTTTCAATAGAGGAAGGAGATGCAAAGTCCCGTGAGTTCGGAATCATGTTCATAGAAACCAGTGCAAAAGCAGGCTTCAATATCAAGCCTTTGTTTCGTAAGATTGCTGCTGCCTTGCCAGGGATGGAAACTCTTTCTTCTACAAAGCAGGAAGACATGGTCGATGTAAATTTAAAACCCACGGTGAATTCATCCCAGACAGAGCAACAAGGAGGAGGTTGCTCATGCTAG
Predicted protein sequences of Glyma.05g178300
>Glyma.05g178300.1.p sequence-type=predicted peptide transcript=Glyma.05g178300.1 locus=Glyma.05g178300 ID=Glyma.05g178300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTNKWVEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKSREFGIMFIETSAKAGFNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTVNSSQTEQQGGGCSC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo