Report for Sequence Feature Glyma.05g140300
| Feature Type: | gene_model |
| Chromosome: | Gm05 |
| Start: | 33330522 |
| stop: | 33335962 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.05g140300
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT1G06515.2 | AT |
|
JGI | N/A | IEA |
| PTHR33727 | PantherFam |
OS07G0446900 PROTEIN |
JGI | N/A | IEA |
| PF11779 | Pfam |
Small subunit of serine palmitoyltransferase-like |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.05g140300 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma05g27160 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.05g140300
>Glyma.05g140300.1 sequence-type=CDS polypeptide=Glyma.05g140300.1.p locus=Glyma.05g140300 id=Glyma.05g140300.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGAATTGGATACAGCGCAAGATCTACCTTTACAATGTGACTTTTGGGCTGTATATGTTGGACTGGTGGGAGCGTTGTACCTTCAATATTGTGGTGATTGTATTAATGTGTTTCGTTCTACGATATGTTACTCAGTTCTTCAAGAGGTATGTTTGGTAA
Predicted protein sequences of Glyma.05g140300
>Glyma.05g140300.1.p sequence-type=predicted peptide transcript=Glyma.05g140300.1 locus=Glyma.05g140300 id=Glyma.05g140300.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MNWIQRKIYLYNVTFGLYMLDWWERCTFNIVVIVLMCFVLRYVTQFFKRYVW*