SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.05g117800

Feature Type:gene_model
Chromosome:Gm05
Start:31086817
stop:31087153
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.05g117800
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G56891.1AT Heavy metal transport/detoxification superfamily protein JGI N/AIEA
GO:0030001GO-bp metal ion transport EnsemblGenomesN/AIEA
GO:0030001GO-bp metal ion transport JGI N/AIEA
GO:0046872GO-mf metal ion binding EnsemblGenomesN/AIEA
GO:0046872GO-mf metal ion binding JGI N/AIEA
KOG1603 KOG Copper chaperone JGI N/AIEA
PF00403PFAM Heavy-metal-associated domain JGI N/AIEA

Expression Patterns of Glyma.05g117800
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.05g117800 not represented in the dataset
Glyma.05g117800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.05g117800
ParalogEvidenceComments
Glyma.08g072700 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.


Coding sequences of Glyma.05g117800
>Glyma.05g117800.1 sequence-type=CDS polypeptide=Glyma.05g117800.1.p locus=Glyma.05g117800 ID=Glyma.05g117800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGTTTGTATACATGAGAAAAGACTAAGGAAATGCCTCTCAAAATTAAAAGGGATAGAAAAAGTGGAAGTGGATACTAACTGCCAGAAAGTAGTAGTGACTGGATACACACACAAGAACAAAATCCTAAAAGCAGTTAGGAGAGGGGGTCTCAAAGCTGACTTCTGGTCTGCTCAGAATGAGTTCCTTAATGCTTATGTCAGTTCCAATTATGCCAACTTTAGATTCAACCCCTTCAACTTCTTCTAA
Predicted protein sequences of Glyma.05g117800
>Glyma.05g117800.1.p sequence-type=predicted peptide transcript=Glyma.05g117800.1 locus=Glyma.05g117800 ID=Glyma.05g117800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MVCIHEKRLRKCLSKLKGIEKVEVDTNCQKVVVTGYTHKNKILKAVRRGGLKADFWSAQNEFLNAYVSSNYANFRFNPFNFF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo