SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.05g113900

Feature Type:gene_model
Chromosome:Gm05
Start:30159777
stop:30160146
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.05g113900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G34640.1AT squalene synthase 1 JGI N/AIEA
GO:0016126GO-bp sterol biosynthetic process EnsemblGenomesN/AIEA
GO:0045338GO-bp farnesyl diphosphate metabolic process EnsemblGenomesN/AIEA
GO:0005789GO-cc endoplasmic reticulum membrane EnsemblGenomesN/AIEA
GO:0004310GO-mf farnesyl-diphosphate farnesyltransferase activity EnsemblGenomesN/AIEA
GO:0051996GO-mf squalene synthase activity EnsemblGenomesN/AIEA
PTHR11626Panther FARNESYL-DIPHOSPHATE FARNESYLTRANSFERASE JGI N/AIEA
PWY-2541SoyCyc9 plant sterol biosynthesis Plant Metabolic Network ISS
PWY-5670SoyCyc9 epoxysqualene biosynthesis Plant Metabolic Network ISS
PWY-6663SoyCyc9 plant sterol biosynthesis II Plant Metabolic Network ISS
GN7V-64978SoyCyc9-rxn squalene synthase Plant Metabolic Network ISS

Expression Patterns of Glyma.05g113900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.05g113900 not represented in the dataset
Glyma.05g113900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.05g113900 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma05g23931 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.05g113900
>Glyma.05g113900.1 sequence-type=CDS polypeptide=Glyma.05g113900.1.p locus=Glyma.05g113900 ID=Glyma.05g113900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCTCCACAAGGTTTCTCGAAGTTTCACCCTCGTCATTCACCAACTCGGCACCGAGCTTCGTAACGCCGCTAGTACCTCGCATTTCTCGTTCTACCTACACCGTTCTGCTGAGGATGATACTAGCATAGAAACAGATGTCAAGGTGCCAATACTGATAGCCTTTCACTGTCATATTTATGATCGTGATTGGCACTTTTCATGTGAGTGTGTCATTCTTTTTTGCTTTTCTTTTTTTAAATAA
Predicted protein sequences of Glyma.05g113900
>Glyma.05g113900.1.p sequence-type=predicted peptide transcript=Glyma.05g113900.1 locus=Glyma.05g113900 ID=Glyma.05g113900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MLHKVSRSFTLVIHQLGTELRNAASTSHFSFYLHRSAEDDTSIETDVKVPILIAFHCHIYDRDWHFSCECVILFCFSFFK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo