Glyma.05g110100

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.05g110100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.05g110100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.05g110100

Feature Type:	gene_model
Chromosome:	Gm05
Start:	29185309
stop:	29188430
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.05g110100

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G37830.1	AT	cytochrome c oxidase-related	JGI	N/A	IEA
GO:0006123	GO-bp	mitochondrial electron transport, cytochrome c to oxygen	EnsemblGenomes	N/A	IEA
GO:0009060	GO-bp	aerobic respiration	EnsemblGenomes	N/A	IEA
GO:0022900	GO-bp	electron transport chain	EnsemblGenomes	N/A	IEA
GO:0050790	GO-bp	regulation of catalytic activity	EnsemblGenomes	N/A	IEA
GO:1902600	GO-bp	proton transmembrane transport	EnsemblGenomes	N/A	IEA
GO:0005743	GO-cc	mitochondrial inner membrane	EnsemblGenomes	N/A	IEA
GO:0005743	GO-cc	mitochondrial inner membrane	JGI	N/A	IEA
GO:0005751	GO-cc	mitochondrial respiratory chain complex IV	EnsemblGenomes	N/A	IEA
GO:0005751	GO-cc	mitochondrial respiratory chain complex IV	JGI	N/A	IEA
GO:0004129	GO-mf	cytochrome-c oxidase activity	EnsemblGenomes	N/A	IEA
GO:0004129	GO-mf	cytochrome-c oxidase activity	JGI	N/A	IEA
GO:0030234	GO-mf	enzyme regulator activity	EnsemblGenomes	N/A	IEA
KOG3469	KOG	Cytochrome c oxidase, subunit VIa/COX13	JGI	N/A	IEA
PTHR11504	Panther	CYTOCHROME C OXIDASE POLYPEPTIDE VIA	JGI	N/A	IEA
PF02046	PFAM	Cytochrome c oxidase subunit VIa	JGI	N/A	IEA
PWY-3781	SoyCyc9	aerobic respiration I (cytochrome c)	Plant Metabolic Network		ISS
GN7V-64745	SoyCyc9-rxn	cytochrome-c oxidase	Plant Metabolic Network		ISS

Expression Patterns of Glyma.05g110100

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.05g110100 not represented in the dataset	Glyma.05g110100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.05g110100

Paralog	Evidence	Comments
Glyma.17g157000	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.05g110100 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma05g23220	Wm82.a1.v1.1	IGC	As supplied by JGI

Transcripts of Glyma.05g110100

Limit To All Plant Sequences

>Glyma.05g110100.2 sequence-type=transcript locus=Glyma.05g110100 ID=Glyma.05g110100.2.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATTGTTTCTTACCCCTTCAAAGCAAATACAGAAAAAAAGAGTCAAGCGGCGAGCAATGGCGACATCGCTGGTGCGATCGGGTTTTCTTCGAAGCGCCCTAAGAGGAAGCGCTCGTGGCTCCCAGGTTCCGAAGCGAAACTTTGCTTCCTCTGGTCATCACGATGATGCATATGAGACGGCCAAATGGGAGAAGATTACATATCTAGGCATTGTTAGTTGCACTGGTTTAGCCGTTTATAATCTATCAAAGGGCCACCCACACTTCAAAGAACCTCCTGCTTACCCATATTTGCATATCCGCAATAAGGAATTCCCCTGGGCATTTGCCAAGCCCATCCTGCTTCCAATCTAAGGATTTGTGAGAACTTAGCATTCATTTTTTATAAGCATGGCATGTTCTTGTCCCGATGGACTATTTGAAACGAAGCACCATGAAGAGCATTAGTGGTTTAATGAAGGTATTTGTGGCACTGGTGGGCATTCGTTTTGTCAATGTTCAACGAATAGTGATAATGATGATTATTGTGATTTTTGAAATGTGATCTAGAACTTGCACTTGGCAACGTTAGTTTGTCATGTTTTTATCTCATGTTCGTTTGTATGGTTGAAACAAAATAAATTTGTCAAACAATATGATGCTTCTTTTTATGCCGATTCTTGTTCAGTAAGATTTTTAAAGAAAATGATCTTAAGACCCCAGACTTTTATC

Coding sequences of Glyma.05g110100

Limit To All Plant Sequences

>Glyma.05g110100.1 sequence-type=CDS polypeptide=Glyma.05g110100.1.p locus=Glyma.05g110100 ID=Glyma.05g110100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCGACATCGCTGGTGCGATCGGGTTTTCTTCGAAGCGCCCTAAGAGGAAGCGCTCGTGGCTCCCAGGTTCCGAAGCGAAACTTTGCTTCCTCTGGTCATCACGATGATGCATATGAGACGGCCAAATGGGAGAAGATTACATATCTAGGCATTGTTAGTTGCACTGGTTTAGCCGTTTATAATCTATCAAAGGGCCACCCACACTTCAAAGAACCTCCTGCTTACCCATATTTGCATATCCGCAATAAGGAATTCCCCTGGGGTCCCGATGGACTATTTGAAACGAAGCACCATGAAGAGCATTAG

>Glyma.05g110100.2 sequence-type=CDS polypeptide=Glyma.05g110100.2.p locus=Glyma.05g110100 ID=Glyma.05g110100.2.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCGACATCGCTGGTGCGATCGGGTTTTCTTCGAAGCGCCCTAAGAGGAAGCGCTCGTGGCTCCCAGGTTCCGAAGCGAAACTTTGCTTCCTCTGGTCATCACGATGATGCATATGAGACGGCCAAATGGGAGAAGATTACATATCTAGGCATTGTTAGTTGCACTGGTTTAGCCGTTTATAATCTATCAAAGGGCCACCCACACTTCAAAGAACCTCCTGCTTACCCATATTTGCATATCCGCAATAAGGAATTCCCCTGGGCATTTGCCAAGCCCATCCTGCTTCCAATCTAA

Predicted protein sequences of Glyma.05g110100

Limit To All Plant Sequences

>Glyma.05g110100.1.p sequence-type=predicted peptide transcript=Glyma.05g110100.1 locus=Glyma.05g110100 ID=Glyma.05g110100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MATSLVRSGFLRSALRGSARGSQVPKRNFASSGHHDDAYETAKWEKITYLGIVSCTGLAVYNLSKGHPHFKEPPAYPYLHIRNKEFPWGPDGLFETKHHEEH*

>Glyma.05g110100.2.p sequence-type=predicted peptide transcript=Glyma.05g110100.2 locus=Glyma.05g110100 ID=Glyma.05g110100.2.Wm82.a2.v1 annot-version=Wm82.a2.v1
MATSLVRSGFLRSALRGSARGSQVPKRNFASSGHHDDAYETAKWEKITYLGIVSCTGLAVYNLSKGHPHFKEPPAYPYLHIRNKEFPWAFAKPILLPI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain