|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G18680.1 | AT | Amino acid kinase family protein | JGI | N/A | IEA |
| GO:0009089 | GO-bp | lysine biosynthetic process via diaminopimelate | EnsemblGenomes | N/A | IEA |
| GO:0016310 | GO-bp | phosphorylation | EnsemblGenomes | N/A | IEA |
| GO:0005737 | GO-cc | cytoplasm | EnsemblGenomes | N/A | IEA |
| GO:0004072 | GO-mf | aspartate kinase activity | EnsemblGenomes | N/A | IEA |
| PTHR26059 | Panther | JGI | N/A | IEA | |
| PTHR26059:SF1 | Panther | JGI | N/A | IEA | |
| PWY-5687 | SoyCyc9 | pyrimidine ribonucleotides interconversion | Plant Metabolic Network | ISS | |
| PWY-7176 | SoyCyc9 | UTP and CTP de novo biosynthesis | Plant Metabolic Network | ISS | |
| PWY-7196 | SoyCyc9 | superpathway of pyrimidine ribonucleosides salvage | Plant Metabolic Network | ISS | |
| PWY-7208 | SoyCyc9 | superpathway of pyrimidine nucleobases salvage | Plant Metabolic Network | ISS | |
| PWY-7211 | SoyCyc9 | superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis | Plant Metabolic Network | ISS | |
| PWY0-162 | SoyCyc9 | superpathway of pyrimidine ribonucleotides de novo biosynthesis | Plant Metabolic Network | ISS | |
| GN7V-64854 | SoyCyc9-rxn | UMP kinase | Plant Metabolic Network | ISS |
|
Glyma.05g095600 not represented in the dataset |
Glyma.05g095600 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma05g20400 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.05g095600.1 sequence-type=CDS polypeptide=Glyma.05g095600.1.p locus=Glyma.05g095600 ID=Glyma.05g095600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGACTTGGAAGGGAAAACCGTCAAGCTGCAGATAGTGAGTATTCTCAGGAAGTTCGAGATTCCGTCCATGTCTCACTTGAGACTCTCAATGAACGAAAGTAGCAAGCCTTCATTTAAATGGCGAAGGGTTTTGCTCAAAGTTAGCGGAGAAGCACTTGCTGGAGACCACTCTCAGAACATTGACCCTAAGATAACCATGGCCATTGCAAGGGAGGTGGCAGCAGTGACACGCCTTGGCATTGAGGTGACTACAATGGATTCTTTTATTCTAATACTTTTTTGTTTCTTTTCATATTCATAG
>Glyma.05g095600.1.p sequence-type=predicted peptide transcript=Glyma.05g095600.1 locus=Glyma.05g095600 ID=Glyma.05g095600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MDLEGKTVKLQIVSILRKFEIPSMSHLRLSMNESSKPSFKWRRVLLKVSGEALAGDHSQNIDPKITMAIAREVAAVTRLGIEVTTMDSFILILFCFFSYS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||