Report for Sequence Feature Glyma.05g063300
| Feature Type: | gene_model |
| Chromosome: | Gm05 |
| Start: | 6185819 |
| stop: | 6189912 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.05g063300
Gene model name correspondences to Glyma.05g063300 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma05g05076 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.05g063300
>Glyma.05g063300.3 sequence-type=CDS polypeptide=Glyma.05g063300.3.p locus=Glyma.05g063300 id=Glyma.05g063300.3.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGCAAATTGCCCATCCCCACACCAAACCATCTTCAAACAAAGCACAGGTGCATGGCCTGTTGCCTCACAGTGACACTAGTTTTGTTACCATCGTACATGAGGACCATGTTGGAGGATTGCAATTGATGAAAGACGGAAAATGGGTTGGTGTCAAGCCTAATCCACAAGCTCTGGTCGTTAATATTGCCGACTTCTTTCAGGTGAAATCTCTTCATTTATTTTATTTTAGAGCAACTGATGTTATATTTTTATGCAATATCTTATTTATCTTCCTAACACTAAATAAAGAAAGAATTAAATAA
Predicted protein sequences of Glyma.05g063300
>Glyma.05g063300.3.p sequence-type=predicted peptide transcript=Glyma.05g063300.3 locus=Glyma.05g063300 id=Glyma.05g063300.3.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MQIAHPHTKPSSNKAQVHGLLPHSDTSFVTIVHEDHVGGLQLMKDGKWVGVKPNPQALVVNIADFFQVKSLHLFYFRATDVIFLCNILFIFLTLNKERIK*