SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.05g052400

Feature Type:gene_model
Chromosome:Gm05
Start:4704019
stop:4706164
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.05g052400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G00100.1AT ribosomal protein S13A JGI N/AIEA
GO:0006412GO-bp translation EnsemblGenomesN/AIEA
GO:0006412GO-bp translation JGI N/AIEA
GO:0005622GO-cc intracellular EnsemblGenomesN/AIEA
GO:0005622GO-cc intracellular JGI N/AIEA
GO:0005730GO-cc nucleolus EnsemblGenomesN/AIEA
GO:0005840GO-cc ribosome EnsemblGenomesN/AIEA
GO:0005840GO-cc ribosome JGI N/AIEA
GO:0022627GO-cc cytosolic small ribosomal subunit EnsemblGenomesN/AIEA
GO:0003735GO-mf structural constituent of ribosome EnsemblGenomesN/AIEA
GO:0003735GO-mf structural constituent of ribosome JGI N/AIEA
GO:0070181GO-mf small ribosomal subunit rRNA binding EnsemblGenomesN/AIEA
KOG0400 KOG 40S ribosomal protein S13 JGI N/AIEA
PTHR11885Panther RIBOSOMAL PROTEIN S15P/S13E JGI N/AIEA
PF00312PFAM Ribosomal protein S15 JGI N/AIEA
PF08069PFAM Ribosomal S13/S15 N-terminal domain JGI N/AIEA

Proteins Associated with Glyma.05g052400
LocusGene SymbolProtein Name
RPS13 ribosomal protein S13

Expression Patterns of Glyma.05g052400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.05g052400 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma05g03880 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.05g052400
>Glyma.05g052400.1 sequence-type=CDS polypeptide=Glyma.05g052400.1.p locus=Glyma.05g052400 ID=Glyma.05g052400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGGTCGTATGCACAGCCGCGGTAAGGGTATATCCTCTTCTGCTTTGCCCTACAAAAGGACACCTCCTAGCTGGCTCAAGATCTCTTCGCAAGATGTCGAAGAAAATATCTGCAAGTTTGCGAAGAAAGGTTTGACCCCGTCTCAGATTGGTGTCATTCTCAGAGATTCTCACGGTATTGCTCAGGTCAATAGCGTCACTGGCAGCAAAATCCTTCGCATCCTCAAAGCTCACGGACTTGCGCCTGAAATTCCAGAGGATCTGTACCATTTGATTAAGAAGGCAGTTTCAATTAGGAAGCATCTTGAGAGGAACAGGAAGGACAAGGACTCCAAGTTCAGGTTGATTCTTGTTGAGAGCAGAATCCACCGACTTGCTCGCTATTACAAGAAGACTAAGAAGCTCCCACCAGTCTGGAAGTACGAATCAACAACTGCTAGCACTCTGGTTGCTTAG
Predicted protein sequences of Glyma.05g052400
>Glyma.05g052400.1.p sequence-type=predicted peptide transcript=Glyma.05g052400.1 locus=Glyma.05g052400 ID=Glyma.05g052400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MGRMHSRGKGISSSALPYKRTPPSWLKISSQDVEENICKFAKKGLTPSQIGVILRDSHGIAQVNSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVSIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo