|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G00100.1 | AT | ribosomal protein S13A | JGI | N/A | IEA |
| GO:0006412 | GO-bp | translation | EnsemblGenomes | N/A | IEA |
| GO:0006412 | GO-bp | translation | JGI | N/A | IEA |
| GO:0005622 | GO-cc | intracellular | EnsemblGenomes | N/A | IEA |
| GO:0005622 | GO-cc | intracellular | JGI | N/A | IEA |
| GO:0005730 | GO-cc | nucleolus | EnsemblGenomes | N/A | IEA |
| GO:0005840 | GO-cc | ribosome | EnsemblGenomes | N/A | IEA |
| GO:0005840 | GO-cc | ribosome | JGI | N/A | IEA |
| GO:0022627 | GO-cc | cytosolic small ribosomal subunit | EnsemblGenomes | N/A | IEA |
| GO:0003735 | GO-mf | structural constituent of ribosome | EnsemblGenomes | N/A | IEA |
| GO:0003735 | GO-mf | structural constituent of ribosome | JGI | N/A | IEA |
| GO:0070181 | GO-mf | small ribosomal subunit rRNA binding | EnsemblGenomes | N/A | IEA |
| KOG0400 | KOG | 40S ribosomal protein S13 | JGI | N/A | IEA |
| PTHR11885 | Panther | RIBOSOMAL PROTEIN S15P/S13E | JGI | N/A | IEA |
| PF00312 | PFAM | Ribosomal protein S15 | JGI | N/A | IEA |
| PF08069 | PFAM | Ribosomal S13/S15 N-terminal domain | JGI | N/A | IEA |
| Locus | Gene Symbol | Protein Name |
|---|---|---|
| RPS13 | ribosomal protein S13 |
|
Glyma.05g052400 not represented in the dataset |
Glyma.05g052400 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma05g03880 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.05g052400.1 sequence-type=CDS polypeptide=Glyma.05g052400.1.p locus=Glyma.05g052400 ID=Glyma.05g052400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGGTCGTATGCACAGCCGCGGTAAGGGTATATCCTCTTCTGCTTTGCCCTACAAAAGGACACCTCCTAGCTGGCTCAAGATCTCTTCGCAAGATGTCGAAGAAAATATCTGCAAGTTTGCGAAGAAAGGTTTGACCCCGTCTCAGATTGGTGTCATTCTCAGAGATTCTCACGGTATTGCTCAGGTCAATAGCGTCACTGGCAGCAAAATCCTTCGCATCCTCAAAGCTCACGGACTTGCGCCTGAAATTCCAGAGGATCTGTACCATTTGATTAAGAAGGCAGTTTCAATTAGGAAGCATCTTGAGAGGAACAGGAAGGACAAGGACTCCAAGTTCAGGTTGATTCTTGTTGAGAGCAGAATCCACCGACTTGCTCGCTATTACAAGAAGACTAAGAAGCTCCCACCAGTCTGGAAGTACGAATCAACAACTGCTAGCACTCTGGTTGCTTAG
>Glyma.05g052400.1.p sequence-type=predicted peptide transcript=Glyma.05g052400.1 locus=Glyma.05g052400 ID=Glyma.05g052400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MGRMHSRGKGISSSALPYKRTPPSWLKISSQDVEENICKFAKKGLTPSQIGVILRDSHGIAQVNSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVSIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||