|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G27190.1 | AT | uridine kinase-like 2 | JGI | N/A | IEA |
GO:0009116 | GO-bp | nucleoside metabolic process | EnsemblGenomes | N/A | IEA |
GO:0044206 | GO-bp | UMP salvage | EnsemblGenomes | N/A | IEA |
GO:0004849 | GO-mf | uridine kinase activity | EnsemblGenomes | N/A | IEA |
PTHR10285 | Panther | URIDINE KINASE | JGI | N/A | IEA |
PWY-7183 | SoyCyc9 | pyrimidine nucleobases salvage I | Plant Metabolic Network | ISS | |
PWY-7193 | SoyCyc9 | pyrimidine ribonucleosides salvage I | Plant Metabolic Network | ISS | |
PWY-7196 | SoyCyc9 | superpathway of pyrimidine ribonucleosides salvage | Plant Metabolic Network | ISS | |
PWY-7208 | SoyCyc9 | superpathway of pyrimidine nucleobases salvage | Plant Metabolic Network | ISS | |
PWYQT-4445 | SoyCyc9 | pyrimidine salvage pathway | Plant Metabolic Network | ISS | |
GN7V-66031 | SoyCyc9-rxn | uridine kinase | Plant Metabolic Network | ISS |
Glyma.05g047200 not represented in the dataset |
Glyma.05g047200 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Paralog | Evidence | Comments |
---|---|---|
Glyma.17g129000 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
>Glyma.05g047200.1 sequence-type=CDS polypeptide=Glyma.05g047200.1.p locus=Glyma.05g047200 ID=Glyma.05g047200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGACAGAAAGTCTACAACAAGAAGCTTCCTACTCCATTGCGCTTATTTATGATACGCTTCCTAAAGATATTTCGGAGAGCCATGTTCTTCTCATGGACCCAGTACTAGGGACATCAATCAAGCTTCTTATAAAGAAGGGAGTTTCAGAGTCCCGGATAATATTCCTTAACCTCATTTCTGCTCCTGAGGGAATACTTTGTGTATGTAAACGTTTTCTGCATCTGAAAATCATCACATCGGAGATCGAAGAAGGATTAAAAGAGCAGTTCCATGTCATACCAGGGTTAGGAGAATTTGGTGATCGCTACTTTGGTACGGACGATTCTTAG
>Glyma.05g047200.1.p sequence-type=predicted peptide transcript=Glyma.05g047200.1 locus=Glyma.05g047200 ID=Glyma.05g047200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MTESLQQEASYSIALIYDTLPKDISESHVLLMDPVLGTSIKLLIKKGVSESRIIFLNLISAPEGILCVCKRFLHLKIITSEIEEGLKEQFHVIPGLGEFGDRYFGTDDS*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||