SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.05g045200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.05g045200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.05g045200

Feature Type:gene_model
Chromosome:Gm05
Start:4018865
stop:4023018
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G63310.1AT nucleoside diphosphate kinase 2 JGI N/AIEA
GO:0006165GO-bp nucleoside diphosphate phosphorylation EnsemblGenomesN/AIEA
GO:0006165GO-bp nucleoside diphosphate phosphorylation JGI N/AIEA
GO:0006183GO-bp GTP biosynthetic process EnsemblGenomesN/AIEA
GO:0006183GO-bp GTP biosynthetic process JGI N/AIEA
GO:0006228GO-bp UTP biosynthetic process EnsemblGenomesN/AIEA
GO:0006228GO-bp UTP biosynthetic process JGI N/AIEA
GO:0006241GO-bp CTP biosynthetic process EnsemblGenomesN/AIEA
GO:0006241GO-bp CTP biosynthetic process JGI N/AIEA
GO:0016310GO-bp phosphorylation EnsemblGenomesN/AIEA
GO:0005622GO-cc intracellular EnsemblGenomesN/AIEA
GO:0000166GO-mf nucleotide binding EnsemblGenomesN/AIEA
GO:0004550GO-mf nucleoside diphosphate kinase activity EnsemblGenomesN/AIEA
GO:0004550GO-mf nucleoside diphosphate kinase activity JGI N/AIEA
GO:0005524GO-mf ATP binding EnsemblGenomesN/AIEA
GO:0005524GO-mf ATP binding JGI N/AIEA
GO:0016301GO-mf kinase activity EnsemblGenomesN/AIEA
GO:0016740GO-mf transferase activity EnsemblGenomesN/AIEA
KOG0888 KOG Nucleoside diphosphate kinase JGI N/AIEA
PTHR11349Panther NUCLEOSIDE DIPHOSPHATE KINASE JGI N/AIEA
PF00334PFAM Nucleoside diphosphate kinase JGI N/AIEA
PWY-5687SoyCyc9 pyrimidine ribonucleotides interconversion Plant Metabolic Network ISS
PWY-7176SoyCyc9 UTP and CTP de novo biosynthesis Plant Metabolic Network ISS
PWY-7184SoyCyc9 pyrimidine deoxyribonucleotides de novo biosynthesis I Plant Metabolic Network ISS
PWY-7187SoyCyc9 pyrimidine deoxyribonucleotides de novo biosynthesis II Plant Metabolic Network ISS
PWY-7196SoyCyc9 superpathway of pyrimidine ribonucleosides salvage Plant Metabolic Network ISS
PWY-7197SoyCyc9 pyrimidine deoxyribonucleotide phosphorylation Plant Metabolic Network ISS
PWY-7205SoyCyc9 CMP phosphorylation Plant Metabolic Network ISS
PWY-7208SoyCyc9 superpathway of pyrimidine nucleobases salvage Plant Metabolic Network ISS
PWY-7211SoyCyc9 superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis Plant Metabolic Network ISS
PWY-7221SoyCyc9 guanosine ribonucleotides de novo biosynthesis Plant Metabolic Network ISS
PWY-7224SoyCyc9 purine deoxyribonucleosides salvage Plant Metabolic Network ISS
PWY-7226SoyCyc9 guanosine deoxyribonucleotides de novo biosynthesis I Plant Metabolic Network ISS
PWY-7227SoyCyc9 adenosine deoxyribonucleotides de novo biosynthesis Plant Metabolic Network ISS
PWY-7228SoyCyc9 superpathway of guanosine nucleotides de novo biosynthesis I Plant Metabolic Network ISS
PWY-7229SoyCyc9 superpathway of adenosine nucleotides de novo biosynthesis I Plant Metabolic Network ISS
PWY-841SoyCyc9 superpathway of purine nucleotides de novo biosynthesis I Plant Metabolic Network ISS
PWY0-162SoyCyc9 superpathway of pyrimidine ribonucleotides de novo biosynthesis Plant Metabolic Network ISS
PWY0-166SoyCyc9 superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) Plant Metabolic Network ISS
GN7V-52215SoyCyc9-rxn nucleoside-diphosphate kinase Plant Metabolic Network ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.05g045200 not represented in the dataset

Glyma.05g045200 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.17g127400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Corresponding NameAnnotation VersionEvidenceComments
Glyma05g03010 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.05g045200.1 sequence-type=CDS polypeptide=Glyma.05g045200.1.p locus=Glyma.05g045200 ID=Glyma.05g045200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGAAGCTGTGTGTGGAAGTGTTTGGGTCACATCCTCTCTTCCACGCTCACCCAAGTCCACTCTCTCTCTATTCCGCTCTACTCATCAACACCTAACAGCATTTCCTTCACAATCCCATCTTTTCTTATATCACCCTCCTCCCTATGCTAATGCTAAAACCCTCCGCGCCAGAACCTCCTCCAAACCCGCCATTTTCCTTCCCCACTTAATTGCTTCTCTGGAACAAGTTGACCAGACTTACATAATGGTCAAGCCCGACGGCGTGCAACGTGGCCTCGTGGGAGAAATTATTTCTAGGTTTGAGAAGAAAGGGTTTAAGTTAACTGGCTTGAAGCTCTTCCAGTGCTCAAAGGAATTGGCTGAGGAGCATTACAAGGACCTAAAACAAAAGTCATTCTTCCCCAAGCTGATTGACTATATTACTTCAGGTCCTGTTGTGTGTATGGCTTGGGAGGGTGTTGGGGTAGTCGCATCGGCCCGTAAGCTTATAGGGGCTACAGATCCTCTTCAAGCTGAACCAGGCACAATAAGAGGAGACCTTGCTGTTCAGACAGGAAGGAATGTTGTTCATGGCAGTGACAGTCCTGAGAATGGCAAGCGTGAAATAGCTCTATGGTTCAAGGAAGGCGAAGTATGCGAATGGACCCCAGTCCAAGCACCATGGCTGAGAGAATAA

>Glyma.05g045200.1.p sequence-type=predicted peptide transcript=Glyma.05g045200.1 locus=Glyma.05g045200 ID=Glyma.05g045200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MEAVCGSVWVTSSLPRSPKSTLSLFRSTHQHLTAFPSQSHLFLYHPPPYANAKTLRARTSSKPAIFLPHLIASLEQVDQTYIMVKPDGVQRGLVGEIISRFEKKGFKLTGLKLFQCSKELAEEHYKDLKQKSFFPKLIDYITSGPVVCMAWEGVGVVASARKLIGATDPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIALWFKEGEVCEWTPVQAPWLRE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo