SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.05g035200

Feature Type:gene_model
Chromosome:Gm05
Start:3105274
stop:3109395
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.05g035200
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G48040.1AT RHO-related protein from plants 10 JGI N/AIEA
GO:0007264GO-bp small GTPase mediated signal transduction EnsemblGenomesN/AIEA
GO:0007264GO-bp small GTPase mediated signal transduction JGI N/AIEA
GO:0005622GO-cc intracellular EnsemblGenomesN/AIEA
GO:0005622GO-cc intracellular JGI N/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0000166GO-mf nucleotide binding EnsemblGenomesN/AIEA
GO:0003924GO-mf GTPase activity EnsemblGenomesN/AIEA
GO:0005525GO-mf GTP binding EnsemblGenomesN/AIEA
GO:0005525GO-mf GTP binding JGI N/AIEA
KOG0393 KOG Ras-related small GTPase, Rho type JGI N/AIEA
PTHR24072Panther RHO FAMILY GTPASE JGI N/AIEA
PTHR24072:SF295Panther JGI N/AIEA
PF00071PFAM Ras family JGI N/AIEA

Expression Patterns of Glyma.05g035200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.05g035200
ParalogEvidenceComments
Glyma.17g092100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.05g035200 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma05g01920 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.05g035200
>Glyma.05g035200.1 sequence-type=CDS polypeptide=Glyma.05g035200.1.p locus=Glyma.05g035200 ID=Glyma.05g035200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTGCAACAGCTTCAAGGTTTATCAAGTGTGTGACAGTTGGGGATGGAGCTGTAGGCAAAACTTGCATGCTCATTTGCTATACTAGCAACAAATTCCCCACGGACTATATTCCAACGGTGTTTGATAATTTCAGTGCAAATGTAGTTGTGGAAGGCACAACTGTCAATTTAGGCCTCTGGGACACTGCTGGACAAGAGGATTACAACAGACTGAGGCCTTTGAGCTACAGGGGGGCAGATGTCTTTGTCTTGGCTTTCTCTTTAGTCAGTCATGCAAGCTATGAAAATGTGTTGAAGAAGTGGGTTCCTGAACTGCAGCATTTTGCTCCCGGCATTCCAGTGGTGCTAGTTGGCACCAAATTGGATCTCCGAGAAGACAAGCACTATTTGGCTGATCATCCTGGTCTGGTGCCTGTGACTTCTGAGCAAGGTGAGGAATTGCGTAAACTGGTGGGAGCTACATATTATATAGAGTGCAGCTCAAAAACTCAGCAGAATGTGAAGTCAGTTTTTGATGCTGCTATAAAGGTGGTCATTAAGCCTCCACAAAAACAAGAGAAGAAAAAACCACGTCGAGGGTGTCTACTAAATGTCATCTGTGGAAGGAATATAGTTCGTTTTAAATGA
Predicted protein sequences of Glyma.05g035200
>Glyma.05g035200.1.p sequence-type=predicted peptide transcript=Glyma.05g035200.1 locus=Glyma.05g035200 ID=Glyma.05g035200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAATASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSYRGADVFVLAFSLVSHASYENVLKKWVPELQHFAPGIPVVLVGTKLDLREDKHYLADHPGLVPVTSEQGEELRKLVGATYYIECSSKTQQNVKSVFDAAIKVVIKPPQKQEKKKPRRGCLLNVICGRNIVRFK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo