SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.05g022000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.05g022000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.05g022000

Feature Type:gene_model
Chromosome:Gm05
Start:1924741
stop:1925707
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G07990.1AT Cytochrome P450 superfamily protein JGI N/AIEA
GO:0044550GO-bp secondary metabolite biosynthetic process EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process JGI N/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0004497GO-mf monooxygenase activity EnsemblGenomesN/AIEA
GO:0005506GO-mf iron ion binding EnsemblGenomesN/AIEA
GO:0005506GO-mf iron ion binding JGI N/AIEA
GO:0009055GO-mf electron carrier activity JGI N/AIEA
GO:0016491GO-mf oxidoreductase activity EnsemblGenomesN/AIEA
GO:0016705GO-mf oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen EnsemblGenomesN/AIEA
GO:0016705GO-mf oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen JGI N/AIEA
GO:0016709GO-mf oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen EnsemblGenomesN/AIEA
GO:0020037GO-mf heme binding EnsemblGenomesN/AIEA
GO:0020037GO-mf heme binding JGI N/AIEA
GO:0046872GO-mf metal ion binding EnsemblGenomesN/AIEA
PTHR24298Panther FAMILY NOT NAMED JGI N/AIEA
PTHR24298:SF44Panther JGI N/AIEA
PF00067PFAM Cytochrome P450 JGI N/AIEA
PWY-3101SoyCyc9 flavonol biosynthesis Plant Metabolic Network ISS
PWY-5060SoyCyc9 luteolin biosynthesis Plant Metabolic Network ISS
PWY-7495SoyCyc9 gossypetin metabolism Plant Metabolic Network ISS
GN7V-53078SoyCyc9-rxn flavonoid 3'-monooxygenase Plant Metabolic Network ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.05g022000 not represented in the dataset

Glyma.05g022000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Corresponding NameAnnotation VersionEvidenceComments
Glyma05g00521 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.05g022000.1 sequence-type=CDS polypeptide=Glyma.05g022000.1.p locus=Glyma.05g022000 ID=Glyma.05g022000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGATAGGACGACGACTTTTCAATGACAACATTAGTAGTTTTGATCCTATGGCGGATGAATTTAAATCTATGATGTTGGAGCTTATGAACCCAAGAATTATGGTCCAAGTCCAACAAGAGTTGAATATTGTTGTGGGACAGGATAGGCTTGTGACTGAACTAGATTTGCCCCACCTCCCTTACTTGCAAGTTGTGGTGAAGGAAACGTTACATCTCCACCCACCAACCCCTCTTTCCCTCCCACGACTTGCTAAAAATAGTTGTGAGATATTCAATTATCACATCCCCAAAAGTGCAACTCTCTTGATTAATGTTTGGGCCATAGGACGTGATCTTAAGGAATGGCTTGACCTATTGGAGTTCAAGCCTGAAAGGTTTTTTCTCGATGGTGAGAAGGTTGATGTTGACGTTAAAGGTAATAACTTTGAGCTTCTACCTTTTGGTGTTGGGCGTAAAATATGTGTTGGTATGAGCTTAGGCCTAAAAGCAATTCCTCTTTCCTTCCACCCTCACCCTAGGCTCTCACAACATGTATATTCATCATTGACACCATGA

>Glyma.05g022000.1.p sequence-type=predicted peptide transcript=Glyma.05g022000.1 locus=Glyma.05g022000 ID=Glyma.05g022000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MIGRRLFNDNISSFDPMADEFKSMMLELMNPRIMVQVQQELNIVVGQDRLVTELDLPHLPYLQVVVKETLHLHPPTPLSLPRLAKNSCEIFNYHIPKSATLLINVWAIGRDLKEWLDLLEFKPERFFLDGEKVDVDVKGNNFELLPFGVGRKICVGMSLGLKAIPLSFHPHPRLSQHVYSSLTP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo