|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G52240.2 | AT | RHO guanyl-nucleotide exchange factor 11 | JGI | N/A | IEA |
| GO:0007017 | GO-bp | microtubule-based process | EnsemblGenomes | N/A | IEA |
| GO:0007017 | GO-bp | microtubule-based process | JGI | N/A | IEA |
| GO:0010970 | GO-bp | transport along microtubule | EnsemblGenomes | N/A | IEA |
| GO:0060271 | GO-bp | cilium assembly | EnsemblGenomes | N/A | IEA |
| GO:2000582 | GO-bp | positive regulation of ATP-dependent microtubule motor activity, plus-end-directed | EnsemblGenomes | N/A | IEA |
| GO:0005737 | GO-cc | cytoplasm | EnsemblGenomes | N/A | IEA |
| GO:0005856 | GO-cc | cytoskeleton | EnsemblGenomes | N/A | IEA |
| GO:0005868 | GO-cc | cytoplasmic dynein complex | EnsemblGenomes | N/A | IEA |
| GO:0005874 | GO-cc | microtubule | EnsemblGenomes | N/A | IEA |
| GO:0005875 | GO-cc | microtubule associated complex | JGI | N/A | IEA |
| GO:0030286 | GO-cc | dynein complex | EnsemblGenomes | N/A | IEA |
| GO:0003774 | GO-mf | motor activity | EnsemblGenomes | N/A | IEA |
| GO:0008092 | GO-mf | cytoskeletal protein binding | EnsemblGenomes | N/A | IEA |
| GO:0008574 | GO-mf | ATP-dependent microtubule motor activity, plus-end-directed | EnsemblGenomes | N/A | IEA |
| GO:0045505 | GO-mf | dynein intermediate chain binding | EnsemblGenomes | N/A | IEA |
| GO:0051959 | GO-mf | dynein light intermediate chain binding | EnsemblGenomes | N/A | IEA |
| KOG3430 | KOG | Dynein light chain type 1 | JGI | N/A | IEA |
| PTHR11886 | Panther | DYNEIN LIGHT CHAIN | JGI | N/A | IEA |
| PTHR11886:SF22 | Panther | DYNEIN LIGHT CHAIN TYPE 1-LIKE PROTEIN | JGI | N/A | IEA |
| PF01221 | PFAM | Dynein light chain type 1 | JGI | N/A | IEA |
| GN7V-66794 | SoyCyc9-rxn | dynein ATPase | Plant Metabolic Network | ISS |
|
Glyma.05G230400 not represented in the dataset |
Glyma.05G230400 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.08g037900 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.05g230400 | Wm82.a4.v1 | ISS | As supplied by JGI |
| Glyma05g35501 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.05g230400.1 sequence-type=CDS polypeptide=Glyma.05g230400.1.p locus=Glyma.05g230400 ID=Glyma.05g230400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGTTGGAAGGAAAAGCTATGGTGAAAGAAACAGACATGTCACCCAAGATGCAGATCCATGCCATGGCCTCTGCTTCTCAGGCTCTTGATCTCTACGATGTTTATGATTGCATCTCTATTGCTGCCCATATCAAGAAGGAATTTGATAGTGTGTATGGGAATGGGTGGCAATGTGTGGTGGGATCCAATTTTGGGTGCTATTTCACCCATTCATCAGGGACTTTCATCTATTTTGCTCTGGAGACCCTTAATTTTCTTATCTTTAAGGGAACATCTTCTTGA
>Glyma.05g230400.1.p sequence-type=predicted peptide transcript=Glyma.05g230400.1 locus=Glyma.05g230400 ID=Glyma.05g230400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MLEGKAMVKETDMSPKMQIHAMASASQALDLYDVYDCISIAAHIKKEFDSVYGNGWQCVVGSNFGCYFTHSSGTFIYFALETLNFLIFKGTSS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||