|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G23900.1 | AT | Nucleoside diphosphate kinase family protein | JGI | N/A | IEA |
| GO:0006165 | GO-bp | nucleoside diphosphate phosphorylation | EnsemblGenomes | N/A | IEA |
| GO:0006165 | GO-bp | nucleoside diphosphate phosphorylation | JGI | N/A | IEA |
| GO:0006183 | GO-bp | GTP biosynthetic process | EnsemblGenomes | N/A | IEA |
| GO:0006183 | GO-bp | GTP biosynthetic process | JGI | N/A | IEA |
| GO:0006228 | GO-bp | UTP biosynthetic process | EnsemblGenomes | N/A | IEA |
| GO:0006228 | GO-bp | UTP biosynthetic process | JGI | N/A | IEA |
| GO:0006241 | GO-bp | CTP biosynthetic process | EnsemblGenomes | N/A | IEA |
| GO:0006241 | GO-bp | CTP biosynthetic process | JGI | N/A | IEA |
| GO:0016310 | GO-bp | phosphorylation | EnsemblGenomes | N/A | IEA |
| GO:0005622 | GO-cc | intracellular | EnsemblGenomes | N/A | IEA |
| GO:0000166 | GO-mf | nucleotide binding | EnsemblGenomes | N/A | IEA |
| GO:0004550 | GO-mf | nucleoside diphosphate kinase activity | EnsemblGenomes | N/A | IEA |
| GO:0004550 | GO-mf | nucleoside diphosphate kinase activity | JGI | N/A | IEA |
| GO:0005524 | GO-mf | ATP binding | EnsemblGenomes | N/A | IEA |
| GO:0005524 | GO-mf | ATP binding | JGI | N/A | IEA |
| GO:0016301 | GO-mf | kinase activity | EnsemblGenomes | N/A | IEA |
| GO:0016740 | GO-mf | transferase activity | EnsemblGenomes | N/A | IEA |
| KOG0888 | KOG | Nucleoside diphosphate kinase | JGI | N/A | IEA |
| PTHR11349 | Panther | NUCLEOSIDE DIPHOSPHATE KINASE | JGI | N/A | IEA |
| PF00334 | PFAM | Nucleoside diphosphate kinase | JGI | N/A | IEA |
| PWY-5687 | SoyCyc9 | pyrimidine ribonucleotides interconversion | Plant Metabolic Network | ISS | |
| PWY-7176 | SoyCyc9 | UTP and CTP de novo biosynthesis | Plant Metabolic Network | ISS | |
| PWY-7184 | SoyCyc9 | pyrimidine deoxyribonucleotides de novo biosynthesis I | Plant Metabolic Network | ISS | |
| PWY-7187 | SoyCyc9 | pyrimidine deoxyribonucleotides de novo biosynthesis II | Plant Metabolic Network | ISS | |
| PWY-7196 | SoyCyc9 | superpathway of pyrimidine ribonucleosides salvage | Plant Metabolic Network | ISS | |
| PWY-7197 | SoyCyc9 | pyrimidine deoxyribonucleotide phosphorylation | Plant Metabolic Network | ISS | |
| PWY-7205 | SoyCyc9 | CMP phosphorylation | Plant Metabolic Network | ISS | |
| PWY-7208 | SoyCyc9 | superpathway of pyrimidine nucleobases salvage | Plant Metabolic Network | ISS | |
| PWY-7211 | SoyCyc9 | superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis | Plant Metabolic Network | ISS | |
| PWY-7221 | SoyCyc9 | guanosine ribonucleotides de novo biosynthesis | Plant Metabolic Network | ISS | |
| PWY-7224 | SoyCyc9 | purine deoxyribonucleosides salvage | Plant Metabolic Network | ISS | |
| PWY-7226 | SoyCyc9 | guanosine deoxyribonucleotides de novo biosynthesis I | Plant Metabolic Network | ISS | |
| PWY-7227 | SoyCyc9 | adenosine deoxyribonucleotides de novo biosynthesis | Plant Metabolic Network | ISS | |
| PWY-7228 | SoyCyc9 | superpathway of guanosine nucleotides de novo biosynthesis I | Plant Metabolic Network | ISS | |
| PWY-7229 | SoyCyc9 | superpathway of adenosine nucleotides de novo biosynthesis I | Plant Metabolic Network | ISS | |
| PWY-841 | SoyCyc9 | superpathway of purine nucleotides de novo biosynthesis I | Plant Metabolic Network | ISS | |
| PWY0-162 | SoyCyc9 | superpathway of pyrimidine ribonucleotides de novo biosynthesis | Plant Metabolic Network | ISS | |
| PWY0-166 | SoyCyc9 | superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) | Plant Metabolic Network | ISS | |
| GN7V-62259 | SoyCyc9-rxn | nucleoside-diphosphate kinase | Plant Metabolic Network | ISS |
|
Glyma.05G216700 not represented in the dataset |
Glyma.05G216700 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.08g022500 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.05g216700 | Wm82.a4.v1 | ISS | As supplied by JGI |
| Glyma05g36900 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.05g216700.1 sequence-type=CDS polypeptide=Glyma.05g216700.1.p locus=Glyma.05g216700 ID=Glyma.05g216700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCCTCACAGGTTTGCAAAGCTGCTTCCAGAGCCGCGAGGTCCCTTCTCTCCGCTTCCAGAGCCTCCCATGGACGTGCGGTTGGGGCTGCTACGGCTGTTTCATTGAGCTGCAAAGTGCCTCTTTTCTACGGAAAGAACGGTTCTGGAAGTGGTTCCGCTTCATCATCATCATCATCATGGATTTCAGGAGCACTTGCTCTTCCTGCCGCAGCTTACATGTTCCAAGATCAGGAGGTGCGCGCAGCTGAGCTGGAGCGCACTTTCATTGCCATTAAGCCTGATGGAGTGCAGAGAGGGCTGATTTCTGAGATTATATCTCGTTTTGAGCGGAAAGGGTACAAGCTTGTGGGGATTAAAGTAGTGATTCCTTCAAAGGAATTTGCCCAAAAGCACTATCACGACCTGAAAGAAAGACCCTTCTTCGATGGGCTGTGTGATTTCCTTAGCTCTGGCCCTGTTATTGCAATGGTGTGGGAAGGACAGGGAGTTATTTCCTATGGCCGAAAGCTAATTGGAGCCACAGATCCTCAGAAATCAGAACCTGGAACCATTAGGGGTGATCTTGCTGTTGTTGTTGGAAGAAATATCATTCATGGGAGTGATGGTCCTGAGACTGCCAAGGATGAGATTAAGTTGTGGTTTAAGCCAGAGGAGTTGGTTAGTTTCACTAGCAATGCAGAAAAGTGGGTTTATGGTGTCAACTGA
>Glyma.05g216700.1.p sequence-type=predicted peptide transcript=Glyma.05g216700.1 locus=Glyma.05g216700 ID=Glyma.05g216700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MASQVCKAASRAARSLLSASRASHGRAVGAATAVSLSCKVPLFYGKNGSGSGSASSSSSSWISGALALPAAAYMFQDQEVRAAELERTFIAIKPDGVQRGLISEIISRFERKGYKLVGIKVVIPSKEFAQKHYHDLKERPFFDGLCDFLSSGPVIAMVWEGQGVISYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEIKLWFKPEELVSFTSNAEKWVYGVN*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||