SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.05G124400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.05G124400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.05G124400

Feature Type:gene_model
Chromosome:Gm05
Start:31780682
stop:31781501
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.05G124400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG00540.1AT photosynthetic electron transfer A JGI N/AIEA
GO:0015979GO-bp photosynthesis EnsemblGenomesN/AIEA
GO:0015979GO-bp photosynthesis JGI N/AIEA
GO:0022900GO-bp electron transport chain EnsemblGenomesN/AIEA
GO:0009535GO-cc chloroplast thylakoid membrane EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0031361GO-cc integral component of thylakoid membrane EnsemblGenomesN/AIEA
GO:0031361GO-cc integral component of thylakoid membrane JGI N/AIEA
GO:0005506GO-mf iron ion binding EnsemblGenomesN/AIEA
GO:0005506GO-mf iron ion binding JGI N/AIEA
GO:0009055GO-mf electron transfer activity EnsemblGenomesN/AIEA
GO:0009055GO-mf electron carrier activity JGI N/AIEA
GO:0020037GO-mf heme binding EnsemblGenomesN/AIEA
GO:0020037GO-mf heme binding JGI N/AIEA
PF01333PFAM Apocytochrome F, C-terminal JGI N/AIEA

Expression Patterns of Glyma.05G124400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.05G124400 not represented in the dataset
Glyma.05G124400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.05G124400 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g124400 Wm82.a4.v1ISS As supplied by JGI


Coding sequences of Glyma.05G124400
>Glyma.05g124400.1 sequence-type=CDS polypeptide=Glyma.05g124400.1.p locus=Glyma.05g124400 ID=Glyma.05g124400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGTGTGCCCTCTTTGTTTGCATGTATCCAACGTGAACCCACTGTCTAACATGTATGCATGTGAATCTATCAAACTTGATCAGCCATTAACAAGTAACCCAAATGTGGGTGAATTTGTCCGAGGTCTCTTGTTCTTCTTGACATCTATTATTTTAGCACAAATCTTTTTAGTTCTTAAAAAGAAACAATTTGAGAAGGTTCAATTAACTGCTGGCAGTTCTTATCATGAATTGCAACTTGCAACAACCAGGGGCCTGAATTGGATTCATATGCCCATCATCTTGTATACAAAAAAGAGGTGA
Predicted protein sequences of Glyma.05G124400
>Glyma.05g124400.1.p sequence-type=predicted peptide transcript=Glyma.05g124400.1 locus=Glyma.05g124400 ID=Glyma.05g124400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MVCPLCLHVSNVNPLSNMYACESIKLDQPLTSNPNVGEFVRGLLFFLTSIILAQIFLVLKKKQFEKVQLTAGSSYHELQLATTRGLNWIHMPIILYTKKR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo