|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G22230.1 | AT | Thioesterase superfamily protein | JGI | N/A | IEA |
| PF07977 | PFAM | FabA-like domain | JGI | N/A | IEA |
| FASYN-ELONG-PWY | SoyCyc9 | fatty acid elongation -- saturated | Plant Metabolic Network | ISS | |
| PWY-5156 | SoyCyc9 | superpathway of fatty acid biosynthesis II (plant) | Plant Metabolic Network | ISS | |
| PWY-5971 | SoyCyc9 | palmitate biosynthesis II (bacteria and plants) | Plant Metabolic Network | ISS | |
| PWY-5973 | SoyCyc9 | cis-vaccenate biosynthesis | Plant Metabolic Network | ISS | |
| PWY-5989 | SoyCyc9 | stearate biosynthesis II (bacteria and plants) | Plant Metabolic Network | ISS | |
| PWY-7388 | SoyCyc9 | octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) | Plant Metabolic Network | ISS | |
| GN7V-66817 | SoyCyc9-rxn | fatty-acyl-CoA synthase | Plant Metabolic Network | ISS |
|
Glyma.05G118800 not represented in the dataset |
Glyma.05G118800 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.05g118800 | Wm82.a4.v1 | ISS | As supplied by JGI |
>Glyma.05g118800.1 sequence-type=CDS polypeptide=Glyma.05g118800.1.p locus=Glyma.05g118800 ID=Glyma.05g118800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGTGCAGTCACGCACCATCTGAAAAAGGAGCAGTTGGTGCATTTGGAGACATAGGAATGAATTTCCAAGCTCGAACAACTAGGACAACACGGTTTACAACGTTTTGTTCTCTAGACGCTACAAATGATCCAAAAGAAAACACCCCAATTGAATTAAGTTACCCTGCGTTTCCAACATCATTGGATATCAATAAGATTCGTGACATTCTGCCGCACAGGTTTCCATTTCTTCTAGTGGATAGAGTGATTGAGCACAATCCTGGAGTTTCTGCAGTGGCCATAAAGAATGTGACAATAAATGACAACTTTTTTCCTGGGCATTTTCCAGAAAGACCAATCATGCCTGGTGTTCTCATGGTTTAG
>Glyma.05g118800.1.p sequence-type=predicted peptide transcript=Glyma.05g118800.1 locus=Glyma.05g118800 ID=Glyma.05g118800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MCSHAPSEKGAVGAFGDIGMNFQARTTRTTRFTTFCSLDATNDPKENTPIELSYPAFPTSLDINKIRDILPHRFPFLLVDRVIEHNPGVSAVAIKNVTINDNFFPGHFPERPIMPGVLMV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||