SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.05G114200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.05G114200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.05G114200

Feature Type:gene_model
Chromosome:Gm05
Start:30265486
stop:30267660
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G46240.1AT potassium channel in Arabidopsis thaliana 1 JGI N/AIEA
GO:0000272GO-bp polysaccharide catabolic process EnsemblGenomesN/AIEA
GO:0000272GO-bp polysaccharide catabolic process JGI N/AIEA
GO:0005975GO-bp carbohydrate metabolic process EnsemblGenomesN/AIEA
GO:0006811GO-bp ion transport EnsemblGenomesN/AIEA
GO:0006811GO-bp ion transport JGI N/AIEA
GO:0008152GO-bp metabolic process EnsemblGenomesN/AIEA
GO:0034220GO-bp ion transmembrane transport EnsemblGenomesN/AIEA
GO:0042391GO-bp regulation of membrane potential EnsemblGenomesN/AIEA
GO:0055085GO-bp transmembrane transport EnsemblGenomesN/AIEA
GO:0055085GO-bp transmembrane transport JGI N/AIEA
GO:0071805GO-bp potassium ion transmembrane transport EnsemblGenomesN/AIEA
GO:0005887GO-cc integral component of plasma membrane EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane JGI N/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0005216GO-mf ion channel activity EnsemblGenomesN/AIEA
GO:0005216GO-mf ion channel activity JGI N/AIEA
GO:0005249GO-mf voltage-gated potassium channel activity EnsemblGenomesN/AIEA
GO:0016161GO-mf beta-amylase activity EnsemblGenomesN/AIEA
GO:0016161GO-mf beta-amylase activity JGI N/AIEA
GO:0016787GO-mf hydrolase activity EnsemblGenomesN/AIEA
GO:0016798GO-mf hydrolase activity, acting on glycosyl bonds EnsemblGenomesN/AIEA
GO:0102229GO-mf amylopectin maltohydrolase activity EnsemblGenomesN/AIEA
PTHR10217Panther VOLTAGE AND LIGAND GATED POTASSIUM CHANNEL JGI N/AIEA
PTHR10217:SF6Panther JGI N/AIEA
PF00520PFAM Ion transport protein JGI N/AIEA
PF01373PFAM Glycosyl hydrolase family 14 JGI N/AIEA

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.05G114200 not represented in the dataset

Glyma.05G114200 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g114200 Wm82.a4.v1ISS As supplied by JGI


>Glyma.05g114200.1 sequence-type=CDS polypeptide=Glyma.05g114200.1.p locus=Glyma.05g114200 ID=Glyma.05g114200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGTTTACTTTGATTTCATGAGAAGTTTCCGGGTAGAGTTTGATGAATATTTTGAGGATGGGTTAATCTCTATGATTGAAGTTGGAATGGTTTCGTGTGGAGAACTAAGATACCCATCTTGTTCTGTAAAGCATGGTTGGAGATATCCTGGTATTGGTGAATTCCAGGATGATGACTTTAAGCTAATTGGCAGAATGTCGCCAGCACAAGGAGGATATGGCACATACATGCTTATATTTCAGCAGCCACTAGATATGCAACACTTGGTGCTCCTACTTTGTATGACCATCCTGGCCCAATTTATGGAAGTAGTGGTAGAAAGTTTTTTGGCAAGAAACCAGCATGAGCAGAAGTCAAGAAAACAAAAACATGAGGTTATATCAAGTTCTCTGTTTGCAAGACTTGAAAAGGTCATTCACTTCAATTATTTTTGGACTAGGTGCACAAAGCTCATTATTGTGAACTTGTTTTCGGTGCATTGTGTGGGATGCTTTAACTATCTCATTGCTGATAGGTATCTAGATTCCAAAAGAACATGGATTGGTGCAGTGTACCCAAATTTCAAAGAAGAAAGTCTTTGGGACAAATATGTCACTGCAATATATTGGTCCATTGTCACTGTTACTACCACTGGCTATGGGGATTTACACAAGAGAGATGTTGTTTAA

>Glyma.05g114200.1.p sequence-type=predicted peptide transcript=Glyma.05g114200.1 locus=Glyma.05g114200 ID=Glyma.05g114200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MVYFDFMRSFRVEFDEYFEDGLISMIEVGMVSCGELRYPSCSVKHGWRYPGIGEFQDDDFKLIGRMSPAQGGYGTYMLIFQQPLDMQHLVLLLCMTILAQFMEVVVESFLARNQHEQKSRKQKHEVISSSLFARLEKVIHFNYFWTRCTKLIIVNLFSVHCVGCFNYLIADRYLDSKRTWIGAVYPNFKEESLWDKYVTAIYWSIVTVTTTGYGDLHKRDVV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo