|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| ATCG00140.1 | AT | ATP synthase subunit C family protein | JGI | N/A | IEA |
| GO:0006754 | GO-bp | ATP biosynthetic process | EnsemblGenomes | N/A | IEA |
| GO:0006811 | GO-bp | ion transport | EnsemblGenomes | N/A | IEA |
| GO:0015986 | GO-bp | ATP synthesis coupled proton transport | EnsemblGenomes | N/A | IEA |
| GO:0015991 | GO-bp | ATP hydrolysis coupled proton transport | EnsemblGenomes | N/A | IEA |
| GO:0015991 | GO-bp | ATP hydrolysis coupled proton transport | JGI | N/A | IEA |
| GO:0009507 | GO-cc | chloroplast | EnsemblGenomes | N/A | IEA |
| GO:0009535 | GO-cc | chloroplast thylakoid membrane | EnsemblGenomes | N/A | IEA |
| GO:0009536 | GO-cc | plastid | EnsemblGenomes | N/A | IEA |
| GO:0009579 | GO-cc | thylakoid | EnsemblGenomes | N/A | IEA |
| GO:0016020 | GO-cc | membrane | EnsemblGenomes | N/A | IEA |
| GO:0016021 | GO-cc | integral component of membrane | EnsemblGenomes | N/A | IEA |
| GO:0033177 | GO-cc | proton-transporting two-sector ATPase complex, proton-transporting domain | EnsemblGenomes | N/A | IEA |
| GO:0033177 | GO-cc | proton-transporting two-sector ATPase complex, proton-transporting domain | JGI | N/A | IEA |
| GO:0045263 | GO-cc | proton-transporting ATP synthase complex, coupling factor F(o) | EnsemblGenomes | N/A | IEA |
| GO:0008289 | GO-mf | lipid binding | EnsemblGenomes | N/A | IEA |
| GO:0015078 | GO-mf | proton transmembrane transporter activity | EnsemblGenomes | N/A | IEA |
| GO:0015078 | GO-mf | hydrogen ion transmembrane transporter activity | JGI | N/A | IEA |
| GO:0046933 | GO-mf | proton-transporting ATP synthase activity, rotational mechanism | EnsemblGenomes | N/A | IEA |
| PF00137 | PFAM | ATP synthase subunit C | JGI | N/A | IEA |
|
Glyma.05G099200 not represented in the dataset |
Glyma.05G099200 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
>Glyma.05g099200.1 sequence-type=CDS polypeptide=Glyma.05g099200.1.p locus=Glyma.05g099200 ID=Glyma.05g099200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 GAACTTTCTTACTTTCTTCCTTTTCTCATCCTGCAAGTTCTAAAGGACTACATATTTGGGCCTGCTTCTATTGGACCTAGGGTTGGTCAAGGCACTACTGTAGGGCAAGCTGTAGAAGGGATTGCACGACAACCGGAGGCAGAGGGAAAAATACGAGGTACTTTATTGCTTAGTTTGGCTTTTATGGAAGCCTTAACAATTTATGGATTGGTTGTAGTATTAGCACTTTTATTTGCAAATCCTTTTGTTTAA
>Glyma.05g099200.1.p sequence-type=predicted peptide transcript=Glyma.05g099200.1 locus=Glyma.05g099200 ID=Glyma.05g099200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ELSYFLPFLILQVLKDYIFGPASIGPRVGQGTTVGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVVLALLFANPFV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||