|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G11050.1 | AT | ferritin 2 | JGI | N/A | IEA |
| GO:0006826 | GO-bp | iron ion transport | EnsemblGenomes | N/A | IEA |
| GO:0006879 | GO-bp | cellular iron ion homeostasis | EnsemblGenomes | N/A | IEA |
| GO:0006879 | GO-bp | cellular iron ion homeostasis | JGI | N/A | IEA |
| GO:0006880 | GO-bp | intracellular sequestering of iron ion | EnsemblGenomes | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
| GO:0005623 | GO-cc | cell | EnsemblGenomes | N/A | IEA |
| GO:0005737 | GO-cc | cytoplasm | EnsemblGenomes | N/A | IEA |
| GO:0004322 | GO-mf | ferroxidase activity | EnsemblGenomes | N/A | IEA |
| GO:0005506 | GO-mf | iron ion binding | EnsemblGenomes | N/A | IEA |
| GO:0008199 | GO-mf | ferric iron binding | EnsemblGenomes | N/A | IEA |
| GO:0008199 | GO-mf | ferric iron binding | JGI | N/A | IEA |
| GO:0016491 | GO-mf | oxidoreductase activity | EnsemblGenomes | N/A | IEA |
| GO:0046872 | GO-mf | metal ion binding | EnsemblGenomes | N/A | IEA |
| PTHR11431 | Panther | FERRITIN | JGI | N/A | IEA |
| PTHR11431:SF8 | Panther | JGI | N/A | IEA | |
| PF00210 | PFAM | Ferritin-like domain | JGI | N/A | IEA |
| GN7V-43350 | SoyCyc9-rxn | ferroxidase
| Plant Metabolic Network | ISS |
|
Glyma.05G095400 not represented in the dataset |
Glyma.05G095400 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.05g095400 | Wm82.a4.v1 | ISS | As supplied by JGI |
| Glyma05g20280 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.05g095400.1 sequence-type=CDS polypeptide=Glyma.05g095400.1.p locus=Glyma.05g095400 ID=Glyma.05g095400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGAAGTAGCAATGGAACTTGCCCTGTTGTTGGAGAAGCTGACAAATGAAAAGTTGCTTAACTTGCACAGTGTTGCCTCAAAGAGCAATGATGCGCAATTGTCAGATTTTATTGAAAGCGAGTTTTTGGGTGAACAGGTGGAAGCCATAAAAAAAATCTCTGAATACGTTGCTCAACTTAGAAGAGTTGGAAAAGGACATGGTGTGTGGCACTTTGATCAGATGCTACTCCATGAGGAAGGAGTAGCATTTCACTTCAGGTGTATTTAA
>Glyma.05g095400.1.p sequence-type=predicted peptide transcript=Glyma.05g095400.1 locus=Glyma.05g095400 ID=Glyma.05g095400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MEVAMELALLLEKLTNEKLLNLHSVASKSNDAQLSDFIESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEEGVAFHFRCI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||