Report for Sequence Feature Glyma.04g248400
| Feature Type: | gene_model |
| Chromosome: | Gm04 |
| Start: | 50367669 |
| stop: | 50368700 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.04g248400
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT3G59770.3 | AT |
SAC9 |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.04g248400 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
Coding sequences of Glyma.04g248400
>Glyma.04g248400.1 sequence-type=CDS polypeptide=Glyma.04g248400.1.p locus=Glyma.04g248400 id=Glyma.04g248400.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGTAGCGTGGAGGGAAGCATCAATGGAGATAGAGGGAAGGTGTACAGACACAAGCTTTGAAAACAAAAGAGAAGGTGCTTTGAGGGATACGTCAGTGATCGTGGTGACGCTGGACTTGGACGAGGTCTTCATCATCGCTAGGCTCTACACCAGAACCGACACTCATGTAATCTACATCAATCCGACCACGAGGGCAAGCTAG
Predicted protein sequences of Glyma.04g248400
>Glyma.04g248400.1.p sequence-type=predicted peptide transcript=Glyma.04g248400.1 locus=Glyma.04g248400 id=Glyma.04g248400.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MVAWREASMEIEGRCTDTSFENKREGALRDTSVIVVTLDLDEVFIIARLYTRTDTHVIYINPTTRAS*