Glyma.04g222400

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.04g222400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.04g222400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.04g222400

Feature Type:	gene_model
Chromosome:	Gm04
Start:	49304081
stop:	49306117
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.04g222400

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G05270.1	AT	Chalcone-flavanone isomerase family protein	JGI	N/A	IEA
GO:0009813	GO-bp	flavonoid biosynthetic process	EnsemblGenomes	N/A	IEA
GO:0080167	GO-bp	response to karrikin	EnsemblGenomes	N/A	IEA
GO:0005783	GO-cc	endoplasmic reticulum	EnsemblGenomes	N/A	IEA
GO:0016853	GO-mf	isomerase activity	EnsemblGenomes	N/A	IEA
GO:0016872	GO-mf	intramolecular lyase activity	EnsemblGenomes	N/A	IEA
GO:0016872	GO-mf	intramolecular lyase activity	JGI	N/A	IEA
GO:0045430	GO-mf	chalcone isomerase activity	EnsemblGenomes	N/A	IEA
PF02431	PFAM	Chalcone-flavanone isomerase	JGI	N/A	IEA
PWY-2002	SoyCyc9	isoflavonoid biosynthesis I	Plant Metabolic Network		ISS
PWY-6325	SoyCyc9	echinatin biosynthesis	Plant Metabolic Network		ISS
PWY-6787	SoyCyc9	flavonoid biosynthesis (in equisetum)	Plant Metabolic Network		ISS
PWY1F-FLAVSYN	SoyCyc9	flavonoid biosynthesis	Plant Metabolic Network		ISS
GN7V-60825	SoyCyc9-rxn	chalcone isomerase	Plant Metabolic Network		ISS

Proteins Associated with Glyma.04g222400

Locus	Gene Symbol	Protein Name
	CHI4B	chalcone isomerase 4B

Expression Patterns of Glyma.04g222400

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.04g222400 not represented in the dataset	Glyma.04g222400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.04g222400

Paralog	Evidence	Comments
Glyma.06g143000	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.04g222400 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma04g40030	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.04g222400

Limit To All Plant Sequences

>Glyma.04g222400.1 sequence-type=CDS polypeptide=Glyma.04g222400.1.p locus=Glyma.04g222400 ID=Glyma.04g222400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTACTGAAGAGGTTTTGGTTGATGAAATCACTTACCCTTCCAAGATCACTACTACCAAGCCCCTATCTTTGCTTGGCCATGGAATCACCGACATGGAGATCCACTTTATCCATGTGAAATTCTATTCAATCGGGATTTATTTGGAGCCTGAAGTAGTTGGCCACTTGGAGCAGTTCAAAGGAATATCTGCAAAGGAGCTGGAAGAGAACGATGAGTTCTTCAATGCTCTCATTTCTGCTCCGGTGGAGAAGTTTATTAGACTTGTGGTGATCAAAGAGATCAAGGGTGCACAGTATGGGGTTCAGATTGAGACTGCTGTGAGGGATAGGTTGGCAGCTGAGGACAAATATGAGGAGGAAGAAGAAGAAGCTTTGGAAAAAGTTATTGAATTTTTCCAGTCCAAGTACTTCAAGAAACATTCAGTGATCACATACCATTTCCCAACAAATTCTGCCACTGCTGAGATTGTGGTGTCTTTGGAGGGGAAAGAAGACTCCAAGTATGTGATAGAGAATGCCAATGTGGTAGAGGCAGTTAAGAAATGGTACCTTGGTGGCTCAAGTGCGGTGTCTTCCTCAACCATTCGATCTCTGGCTAGCACTTTCTCGCAGGAGTTGTCCAAGTGA

Predicted protein sequences of Glyma.04g222400

Limit To All Plant Sequences

>Glyma.04g222400.1.p sequence-type=predicted peptide transcript=Glyma.04g222400.1 locus=Glyma.04g222400 ID=Glyma.04g222400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MATEEVLVDEITYPSKITTTKPLSLLGHGITDMEIHFIHVKFYSIGIYLEPEVVGHLEQFKGISAKELEENDEFFNALISAPVEKFIRLVVIKEIKGAQYGVQIETAVRDRLAAEDKYEEEEEEALEKVIEFFQSKYFKKHSVITYHFPTNSATAEIVVSLEGKEDSKYVIENANVVEAVKKWYLGGSSAVSSSTIRSLASTFSQELSK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain