SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.04g204200

Feature Type:gene_model
Chromosome:Gm04
Start:47662234
stop:47664370
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.04g204200
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G04290.1AT Thioesterase superfamily protein JGI N/AIEA
GO:0005737GO-cc cytoplasm EnsemblGenomesN/AIEA
GO:0047617GO-mf acyl-CoA hydrolase activity EnsemblGenomesN/AIEA
PTHR21660Panther THIOESTERASE SUPERFAMILY MEMBER-RELATED JGI N/AIEA
PF03061PFAM Thioesterase superfamily JGI N/AIEA
PWY-1121SoyCyc9 suberin monomers biosynthesis Plant Metabolic Network ISS
PWY-321SoyCyc9 cutin biosynthesis Plant Metabolic Network ISS
PWY-5148SoyCyc9 acyl-CoA hydrolysis Plant Metabolic Network ISS
PWY-6733SoyCyc9 sporopollenin precursors biosynthesis Plant Metabolic Network ISS
GN7V-64998SoyCyc9-rxn acyl-CoA hydrolase Plant Metabolic Network ISS

Expression Patterns of Glyma.04g204200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.04g204200 not represented in the dataset
Glyma.04g204200 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.04g204200 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma04g38135 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.04g204200
>Glyma.04g204200.1 sequence-type=CDS polypeptide=Glyma.04g204200.1.p locus=Glyma.04g204200 ID=Glyma.04g204200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGATTTGGAAAGTATAAACAAGTTGTTGGAGGAAGGAGCCCAAAGCGAGAGTCCATCTCATTCTCTCTCCACTTTCTATTATATCTTCATCTTCTTCTTAACTCATGATTTGTCTATTTTTCCATCGAAGAATGGTGGGAATTCGTTGCACGGTGGTGCCACCGCTACGCTGGTGGCTTTAGTCGGCGCAGCCGCGATTCTCTCTGCCGGACATTCATCCGATTCGGGAGTTTCCGTCGAGATCAACGTCTCCTACTTCGGTGCTGTCTACGCTCATGAGGAGATTGAGATAGATGCTCGGGTTCTACGTGTAGGAAAGGCTGTTGCAGTTGTGAGCGTGGAGTTCAGAAAGAAGAAAACTGGCAAAGTTTTTGCTCAGTGGCGTCACACCAAGTATCTTCCCATTACCAGTAAAATCTGA
Predicted protein sequences of Glyma.04g204200
>Glyma.04g204200.1.p sequence-type=predicted peptide transcript=Glyma.04g204200.1 locus=Glyma.04g204200 ID=Glyma.04g204200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MDLESINKLLEEGAQSESPSHSLSTFYYIFIFFLTHDLSIFPSKNGGNSLHGGATATLVALVGAAAILSAGHSSDSGVSVEINVSYFGAVYAHEEIEIDARVLRVGKAVAVVSVEFRKKKTGKVFAQWRHTKYLPITSKI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo