|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G47770.1 | AT | farnesyl diphosphate synthase 1 | JGI | N/A | IEA |
GO:0008299 | GO-bp | isoprenoid biosynthetic process | EnsemblGenomes | N/A | IEA |
GO:0008299 | GO-bp | isoprenoid biosynthetic process | JGI | N/A | IEA |
GO:0045337 | GO-bp | farnesyl diphosphate biosynthetic process | EnsemblGenomes | N/A | IEA |
GO:0005737 | GO-cc | cytoplasm | EnsemblGenomes | N/A | IEA |
GO:0004161 | GO-mf | dimethylallyltranstransferase activity | EnsemblGenomes | N/A | IEA |
GO:0004337 | GO-mf | geranyltranstransferase activity | EnsemblGenomes | N/A | IEA |
PTHR11525 | Panther | FARNESYL-PYROPHOSPHATE SYNTHETASE | JGI | N/A | IEA |
PF00348 | PFAM | Polyprenyl synthetase | JGI | N/A | IEA |
PWY-5121 | SoyCyc9 | superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) | Plant Metabolic Network | ISS | |
PWY-5122 | SoyCyc9 | geranyl diphosphate biosynthesis | Plant Metabolic Network | ISS | |
PWY-5123 | SoyCyc9 | trans, trans-farnesyl diphosphate biosynthesis | Plant Metabolic Network | ISS | |
PWY-5910 | SoyCyc9 | superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) | Plant Metabolic Network | ISS | |
PWYQT-4449 | SoyCyc9 | polyisoprenoid biosynthesis | Plant Metabolic Network | ISS | |
GN7V-56020 | SoyCyc9-rxn | (2E,6E)-farnesyl diphosphate synthase | Plant Metabolic Network | ISS |
Glyma.04g177500 not represented in the dataset |
Glyma.04g177500 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma04g34770 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.04g177500.1 sequence-type=CDS polypeptide=Glyma.04g177500.1.p locus=Glyma.04g177500 ID=Glyma.04g177500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 GTGACATATGCATTGCTTATGGTGGGTGAGGATCTAGACAAAAATGTTGATGTAAAGAACATTCTTGTTGAGATGGGAACATACTTTCAAGATGATTATTTAGATTGTTTTGGTGATACTCAAACAATTGGAAAGATAGGTACAGATATTGAAGATTTCAAGTGCTCGTGGTTAATTGTGAAAGCCGTGGAACTTAGTAATGAACAACAAAAGAAAGTTCTACAAGCCCTGTACAATGAGCTTAATCTTCAGGAGTACGAGAGTGGGAGCTATGCGAAGGTTGTATCCTCCATTGAAGCTCATCCTAGCAAAGCAGTTCAAGCTGTATTGAAGTCCTTTTTGGCTAAAATTTACAAGAGGCAGAAGTAG
>Glyma.04g177500.1.p sequence-type=predicted peptide transcript=Glyma.04g177500.1 locus=Glyma.04g177500 ID=Glyma.04g177500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 VTYALLMVGEDLDKNVDVKNILVEMGTYFQDDYLDCFGDTQTIGKIGTDIEDFKCSWLIVKAVELSNEQQKKVLQALYNELNLQEYESGSYAKVVSSIEAHPSKAVQAVLKSFLAKIYKRQK*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||