SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.04g177500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.04g177500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.04g177500

Feature Type:gene_model
Chromosome:Gm04
Start:44127707
stop:44128713
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.04g177500
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G47770.1AT farnesyl diphosphate synthase 1 JGI N/AIEA
GO:0008299GO-bp isoprenoid biosynthetic process EnsemblGenomesN/AIEA
GO:0008299GO-bp isoprenoid biosynthetic process JGI N/AIEA
GO:0045337GO-bp farnesyl diphosphate biosynthetic process EnsemblGenomesN/AIEA
GO:0005737GO-cc cytoplasm EnsemblGenomesN/AIEA
GO:0004161GO-mf dimethylallyltranstransferase activity EnsemblGenomesN/AIEA
GO:0004337GO-mf geranyltranstransferase activity EnsemblGenomesN/AIEA
PTHR11525Panther FARNESYL-PYROPHOSPHATE SYNTHETASE JGI N/AIEA
PF00348PFAM Polyprenyl synthetase JGI N/AIEA
PWY-5121SoyCyc9 superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) Plant Metabolic Network ISS
PWY-5122SoyCyc9 geranyl diphosphate biosynthesis Plant Metabolic Network ISS
PWY-5123SoyCyc9 trans, trans-farnesyl diphosphate biosynthesis Plant Metabolic Network ISS
PWY-5910SoyCyc9 superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) Plant Metabolic Network ISS
PWYQT-4449SoyCyc9 polyisoprenoid biosynthesis Plant Metabolic Network ISS
GN7V-56020SoyCyc9-rxn (2E,6E)-farnesyl diphosphate synthase Plant Metabolic Network ISS

Expression Patterns of Glyma.04g177500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.04g177500 not represented in the dataset
Glyma.04g177500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.04g177500 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma04g34770 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.04g177500
>Glyma.04g177500.1 sequence-type=CDS polypeptide=Glyma.04g177500.1.p locus=Glyma.04g177500 ID=Glyma.04g177500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
GTGACATATGCATTGCTTATGGTGGGTGAGGATCTAGACAAAAATGTTGATGTAAAGAACATTCTTGTTGAGATGGGAACATACTTTCAAGATGATTATTTAGATTGTTTTGGTGATACTCAAACAATTGGAAAGATAGGTACAGATATTGAAGATTTCAAGTGCTCGTGGTTAATTGTGAAAGCCGTGGAACTTAGTAATGAACAACAAAAGAAAGTTCTACAAGCCCTGTACAATGAGCTTAATCTTCAGGAGTACGAGAGTGGGAGCTATGCGAAGGTTGTATCCTCCATTGAAGCTCATCCTAGCAAAGCAGTTCAAGCTGTATTGAAGTCCTTTTTGGCTAAAATTTACAAGAGGCAGAAGTAG
Predicted protein sequences of Glyma.04g177500
>Glyma.04g177500.1.p sequence-type=predicted peptide transcript=Glyma.04g177500.1 locus=Glyma.04g177500 ID=Glyma.04g177500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
VTYALLMVGEDLDKNVDVKNILVEMGTYFQDDYLDCFGDTQTIGKIGTDIEDFKCSWLIVKAVELSNEQQKKVLQALYNELNLQEYESGSYAKVVSSIEAHPSKAVQAVLKSFLAKIYKRQK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo