|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G28350.1 | AT | Quinoprotein amine dehydrogenase, beta chain-like; RIC1-like guanyl-nucleotide exchange factor | JGI | N/A | IEA |
GO:0006886 | GO-bp | intracellular protein transport | EnsemblGenomes | N/A | IEA |
GO:0042147 | GO-bp | retrograde transport, endosome to Golgi | EnsemblGenomes | N/A | IEA |
GO:0065009 | GO-bp | regulation of molecular function | EnsemblGenomes | N/A | IEA |
GO:0000139 | GO-cc | Golgi membrane | EnsemblGenomes | N/A | IEA |
GO:0005829 | GO-cc | cytosol | EnsemblGenomes | N/A | IEA |
GO:0034066 | GO-cc | RIC1-RGP1 guanyl-nucleotide exchange factor complex | EnsemblGenomes | N/A | IEA |
GO:0017112 | GO-mf | Rab guanyl-nucleotide exchange factor activity | EnsemblGenomes | N/A | IEA |
GO:0017137 | GO-mf | Rab GTPase binding | EnsemblGenomes | N/A | IEA |
PTHR22746 | Panther | FAMILY NOT NAMED | JGI | N/A | IEA |
PTHR22746:SF4 | Panther | JGI | N/A | IEA |
Glyma.04g176100 not represented in the dataset |
Glyma.04g176100 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma04g34571 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.04g176100.1 sequence-type=CDS polypeptide=Glyma.04g176100.1.p locus=Glyma.04g176100 ID=Glyma.04g176100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGCTGATATTTTCTTTAGGCTTGTTTCATTTTGCTCCATTATTGAATGCTATTTTTTGTTATCAGCTTCCAATGGGAACATTACAGAGCCGTTTGGATGCTGACTTTCTCCTATCTCATATGTGCTCTGTTAAGTTTAAGGAATGGATAGTTGTCCTGGCTACTCTCTTAAGACGTTTTGAGGTATGTTTGGCTTCTCTATGTACAGGACAGTGA
>Glyma.04g176100.1.p sequence-type=predicted peptide transcript=Glyma.04g176100.1 locus=Glyma.04g176100 ID=Glyma.04g176100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MLIFSLGLFHFAPLLNAIFCYQLPMGTLQSRLDADFLLSHMCSVKFKEWIVVLATLLRRFEVCLASLCTGQ*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||