|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G17920.1 | AT | Cobalamin-independent synthase family protein | JGI | N/A | IEA |
| GO:0009086 | GO-bp | methionine biosynthetic process | EnsemblGenomes | N/A | IEA |
| GO:0009086 | GO-bp | methionine biosynthetic process | JGI | N/A | IEA |
| GO:0032259 | GO-bp | methylation | EnsemblGenomes | N/A | IEA |
| GO:0050667 | GO-bp | homocysteine metabolic process | EnsemblGenomes | N/A | IEA |
| GO:0005576 | GO-cc | extracellular region | EnsemblGenomes | N/A | IEA |
| GO:0005829 | GO-cc | cytosol | EnsemblGenomes | N/A | IEA |
| GO:0003871 | GO-mf | 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity | EnsemblGenomes | N/A | IEA |
| GO:0003871 | GO-mf | 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity | JGI | N/A | IEA |
| GO:0008270 | GO-mf | zinc ion binding | EnsemblGenomes | N/A | IEA |
| GO:0008705 | GO-mf | methionine synthase activity | EnsemblGenomes | N/A | IEA |
| PF01717 | PFAM | Cobalamin-independent synthase, Catalytic domain | JGI | N/A | IEA |
| PWY-5041 | SoyCyc9 | S-adenosyl-L-methionine cycle II | Plant Metabolic Network | ISS | |
| PWY-702 | SoyCyc9 | L-methionine biosynthesis II | Plant Metabolic Network | ISS | |
| PWY-724 | SoyCyc9 | superpathway of L-lysine, L-threonine and L-methionine biosynthesis II | Plant Metabolic Network | ISS | |
| GN7V-53330 | SoyCyc9-rxn | 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase | Plant Metabolic Network | ISS |
|
Glyma.04g149000 not represented in the dataset |
Glyma.04g149000 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma04g18235 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.04g149000.1 sequence-type=CDS polypeptide=Glyma.04g149000.1.p locus=Glyma.04g149000 ID=Glyma.04g149000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGTGCTACTCCAACTTCAATGACATCATTCACTCAATCATAAACATGGATGTTGATGTGATCACCATTGAGAACTCCAGATCAGACGAGAATTTACTTTTGGTCATCTGTGAGGGAGTGAAATATCGTGCTGGCATTTATGATATTCATTCACCCAGGATTCCCCCCACAGAAGAAATTGTTGATAGGATCAACAAGATGCTTGTAGTTCTTGAAAGCAACATTCTCTGGGTCAACCCAGATTGTGGCCTTATGACACGCAAATACACCAAGGTCAAACCTGCCCTCACCAATATGGTTGTTGTTATCAAACTTATTTGCAACCAGTTAGCTAGTACCAAGTAA
>Glyma.04g149000.1.p sequence-type=predicted peptide transcript=Glyma.04g149000.1 locus=Glyma.04g149000 ID=Glyma.04g149000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MCYSNFNDIIHSIINMDVDVITIENSRSDENLLLVICEGVKYRAGIYDIHSPRIPPTEEIVDRINKMLVVLESNILWVNPDCGLMTRKYTKVKPALTNMVVVIKLICNQLASTK*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||