Report for Sequence Feature Glyma.04g127200
| Feature Type: | gene_model |
| Chromosome: | Gm04 |
| Start: | 16279876 |
| stop: | 16285203 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Gene model name correspondences to Glyma.04g127200 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma04g15488 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.04g127200
>Glyma.04g127200.1 sequence-type=CDS polypeptide=Glyma.04g127200.1.p locus=Glyma.04g127200 id=Glyma.04g127200.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGAAATTGTCTTCTCCTGCTTGCCTCTTCTCGTGTTCTTCTCCCGCTTGCCTCCTCTCCCACTTGCTTCGCATCTCCCATCTCTCTGACATCTCGTTAGCACCAGCGTGGAGATCATTTGCAATGAGAAAGGAGGGATTCAATGGTACACAAGCCAAACATCATATCAAAACTCTTGAAAAAGGAAGAGGAAAAACCCAAGGGAGTGGTCCCTTCATCCCATGA
Predicted protein sequences of Glyma.04g127200
>Glyma.04g127200.1.p sequence-type=predicted peptide transcript=Glyma.04g127200.1 locus=Glyma.04g127200 id=Glyma.04g127200.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MKLSSPACLFSCSSPACLLSHLLRISHLSDISLAPAWRSFAMRKEGFNGTQAKHHIKTLEKGRGKTQGSGPFIP*