Report for Sequence Feature Glyma.04g075600
| Feature Type: | gene_model |
| Chromosome: | Gm04 |
| Start: | 6305329 |
| stop: | 6306059 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.04g075600
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| PF05553 | Pfam |
Cotton fibre expressed protein |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.04g075600 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
Coding sequences of Glyma.04g075600
>Glyma.04g075600.1 sequence-type=CDS polypeptide=Glyma.04g075600.1.p locus=Glyma.04g075600 id=Glyma.04g075600.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGATACGCAGAATTCTTCACCACTCATCAGACAATTACTGAAGTCTATGAAGAAACTGAAGTCTCTGGTGCACTCTTGGCGAATGCATTCCACTGTATCCAGAAGTTTAAAACAAAGATGGTGTAGATTGTTCAATAAACAAATGGGCATGCAAAGGTTCCTTGAGGATGAAGAAACCACCGAGGATCATATGGTACAATATAGAAGAGCAATAAGTTGTGTTTCGGAAGATGATATTGATAAAAGGGCTGAGGCTTTTATTGCTAACTTTAGACGTCAACTAAGTTTGGAGAGAATATTTAATTATTAG
Predicted protein sequences of Glyma.04g075600
>Glyma.04g075600.1.p sequence-type=predicted peptide transcript=Glyma.04g075600.1 locus=Glyma.04g075600 id=Glyma.04g075600.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MDTQNSSPLIRQLLKSMKKLKSLVHSWRMHSTVSRSLKQRWCRLFNKQMGMQRFLEDEETTEDHMVQYRRAISCVSEDDIDKRAEAFIANFRRQLSLERIFNY*