|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G11770.1 | AT | NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial | JGI | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | JGI | N/A | IEA |
| GO:0008137 | GO-mf | NADH dehydrogenase (ubiquinone) activity | EnsemblGenomes | N/A | IEA |
| GO:0016491 | GO-mf | oxidoreductase activity | EnsemblGenomes | N/A | IEA |
| GO:0046872 | GO-mf | metal ion binding | EnsemblGenomes | N/A | IEA |
| GO:0048038 | GO-mf | quinone binding | EnsemblGenomes | N/A | IEA |
| GO:0051536 | GO-mf | iron-sulfur cluster binding | EnsemblGenomes | N/A | IEA |
| GO:0051536 | GO-mf | iron-sulfur cluster binding | JGI | N/A | IEA |
| GO:0051539 | GO-mf | 4 iron, 4 sulfur cluster binding | EnsemblGenomes | N/A | IEA |
| KOG1687 | KOG | NADH-ubiquinone oxidoreductase, NUFS7/PSST/20 kDa subunit | JGI | N/A | IEA |
| PTHR11995 | Panther | NADH DEHYDROGENASE | JGI | N/A | IEA |
| PF01058 | PFAM | NADH ubiquinone oxidoreductase, 20 Kd subunit | JGI | N/A | IEA |
| PWY-3781 | SoyCyc9 | aerobic respiration I (cytochrome c) | Plant Metabolic Network | ISS | |
| PWY-4302 | SoyCyc9 | aerobic respiration III (alternative oxidase pathway) | Plant Metabolic Network | ISS | |
| PWY-5083 | SoyCyc9 | NAD/NADH phosphorylation and dephosphorylation | Plant Metabolic Network | ISS | |
| GN7V-58407 | SoyCyc9-rxn | NADH:ubiquinone reductase (H+-translocating) | Plant Metabolic Network | ISS |
|
Glyma.04g050600 not represented in the dataset |
Glyma.04g050600 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.06g051400 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma04g05340 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.04g050600.1 sequence-type=CDS polypeptide=Glyma.04g050600.1.p locus=Glyma.04g050600 ID=Glyma.04g050600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCTCTTCTGAGTCGAGCCTCTTCACGCTTCCCTCAGCTGGTTTCCCCTCAAAGAGTTGTTTCCCTCCACACAACGCTCCCATCTCTTAACGCATCAACATCCACACCCACGCCCGCCCCATATGCCCCGCCACCGCCTCCGTCCGCTTCCCCTCCCGCCGGCGTGTCGAAGGCGGCGGAGTTCGTGATCTCGAAGGTTGACGATCTGATGAACTGGGCCCGGCGCGGCTCCATCTGGCCCATGACCTTCGGCCTCGCCTGCTGCGCCGTCGAAATGATGCACACCGGCGCCGCCCGCTACGATCTCGACCGCTTCGGCATCATTTTCAGGCCCAGCCCTCGCCAGTCTGATTGCATGATCGTCGCTGGCACTCTCACCAACAAGATGGCTCCCGCTCTTCGCAAGGTTTATGACCAAATGCCTGAGCCTAGATGGGTTGTCTCAATGGGAAGTTGTGCTAATGGAGGAGGATACTACCATTACTCTTACTCCGTAGTTCGGGGATGTGACAGGATTGTTCCTGTTGACATATATATTCCAGGCTGTCCTCCAACTGCTGAGGCTTTGCTGTATGGACTCCTCCAGCTGCAGAAAAAGATCAATAGGCGCAAAGACTTCCTCCATTGGTGGACAAAGTGA
>Glyma.04g050600.1.p sequence-type=predicted peptide transcript=Glyma.04g050600.1 locus=Glyma.04g050600 ID=Glyma.04g050600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MALLSRASSRFPQLVSPQRVVSLHTTLPSLNASTSTPTPAPYAPPPPPSASPPAGVSKAAEFVISKVDDLMNWARRGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMIVAGTLTNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGLLQLQKKINRRKDFLHWWTK*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||