|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G20240.1 | AT | K-box region and MADS-box transcription factor family protein | JGI | N/A | IEA |
| GO:0006351 | GO-bp | transcription, DNA-templated | EnsemblGenomes | N/A | IEA |
| GO:0006355 | GO-bp | regulation of transcription, DNA-templated | EnsemblGenomes | N/A | IEA |
| GO:0006355 | GO-bp | regulation of transcription, DNA-templated | JGI | N/A | IEA |
| GO:0045944 | GO-bp | positive regulation of transcription by RNA polymerase II | EnsemblGenomes | N/A | IEA |
| GO:0005634 | GO-cc | nucleus | EnsemblGenomes | N/A | IEA |
| GO:0005634 | GO-cc | nucleus | JGI | N/A | IEA |
| GO:0000977 | GO-mf | RNA polymerase II regulatory region sequence-specific DNA binding | EnsemblGenomes | N/A | IEA |
| GO:0003677 | GO-mf | DNA binding | EnsemblGenomes | N/A | IEA |
| GO:0003677 | GO-mf | DNA binding | JGI | N/A | IEA |
| GO:0003700 | GO-mf | DNA binding transcription factor activity | EnsemblGenomes | N/A | IEA |
| GO:0003700 | GO-mf | sequence-specific DNA binding transcription factor activity | JGI | N/A | IEA |
| GO:0046983 | GO-mf | protein dimerization activity | EnsemblGenomes | N/A | IEA |
| GO:0046983 | GO-mf | protein dimerization activity | JGI | N/A | IEA |
| KOG0014 | KOG | MADS box transcription factor | JGI | N/A | IEA |
| PTHR11945 | Panther | MADS BOX PROTEIN | JGI | N/A | IEA |
| PTHR11945:SF134 | Panther | JGI | N/A | IEA | |
| PF00319 | PFAM | SRF-type transcription factor (DNA-binding and dimerisation domain) | JGI | N/A | IEA |
| PF01486 | PFAM | K-box region | JGI | N/A | IEA |
| Locus | Gene Symbol | Protein Name |
|---|---|---|
| PIb | Pistillata gene b |
|
Glyma.04G245500 not represented in the dataset |
Glyma.04G245500 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.06g117600 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.04g245500 | Wm82.a4.v1 | ISS | As supplied by JGI |
| Glyma04g42420 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.04g245500.1 sequence-type=CDS polypeptide=Glyma.04g245500.1.p locus=Glyma.04g245500 ID=Glyma.04g245500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGGGAGGGGTAAGATTGAGATCAAAAGGATTGAGAACTCAAGCAACAGGCAAGTTACCTACTCAAAGAGGAAGAATGGGATCCTTAAGAAGGCAAAGGAAATTAGTGTTCTATGTGATGCTCAAGTTTCCCTTATCATCTTTGGTGTCTCTGGGAAGATGCATGAGTACATCAGCCCCTCCACTACGTTGATTGACGTCCTGGACAGATACCAAAGAGCCTCTGGGAAGACCCTGTGGGATGCTAAGCATGAGAACCTCAGCAATGAAATTGATAGAATCAAGAAAGAGAATGACAGCATGCAAATTGAGCTCAGGCACTTGAAAGGAGAGGACATCACGTCACTGAATTACAAGGAACTGATGGCTCTAGAGGATGCCCTTGAAAATGGCCTCAGTGGAGTCCGTGAGAAAAAGATGGAAGTGCACAGGATGTTCAAGAGAAATGACAAGATTTTGGAGGAGCAAAATAAGGAACTCAATTTCCTTCTGCAACAACATTTGGCACTAGAAGGTGTGGGAAACATGCATGGACAATGGATTTAA
>Glyma.04g245500.1.p sequence-type=predicted peptide transcript=Glyma.04g245500.1 locus=Glyma.04g245500 ID=Glyma.04g245500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MGRGKIEIKRIENSSNRQVTYSKRKNGILKKAKEISVLCDAQVSLIIFGVSGKMHEYISPSTTLIDVLDRYQRASGKTLWDAKHENLSNEIDRIKKENDSMQIELRHLKGEDITSLNYKELMALEDALENGLSGVREKKMEVHRMFKRNDKILEEQNKELNFLLQQHLALEGVGNMHGQWI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||