|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G76680.1 | AT | 12-oxophytodienoate reductase 1 | JGI | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | JGI | N/A | IEA |
| GO:0005622 | GO-cc | intracellular | EnsemblGenomes | N/A | IEA |
| GO:0003824 | GO-mf | catalytic activity | EnsemblGenomes | N/A | IEA |
| GO:0010181 | GO-mf | FMN binding | EnsemblGenomes | N/A | IEA |
| GO:0010181 | GO-mf | FMN binding | JGI | N/A | IEA |
| GO:0016491 | GO-mf | oxidoreductase activity | EnsemblGenomes | N/A | IEA |
| GO:0016491 | GO-mf | oxidoreductase activity | JGI | N/A | IEA |
| PTHR22893 | Panther | NADH OXIDOREDUCTASE-RELATED | JGI | N/A | IEA |
| PTHR22893:SF13 | Panther | JGI | N/A | IEA | |
| PF00724 | PFAM | NADH:flavin oxidoreductase / NADH oxidase family | JGI | N/A | IEA |
| PWY-735 | SoyCyc9 | jasmonic acid biosynthesis | Plant Metabolic Network | ISS | |
| GN7V-60293 | SoyCyc9-rxn | 12-oxophytodienoate reductase | Plant Metabolic Network | ISS |
|
Glyma.04G184800 not represented in the dataset |
Glyma.04G184800 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.04g184800 | Wm82.a4.v1 | ISS | As supplied by JGI |
| Glyma04g35801 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.04g184800.1 sequence-type=CDS polypeptide=Glyma.04g184800.1.p locus=Glyma.04g184800 ID=Glyma.04g184800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGTTGAACAAAAAAATCAGGTCATCCCTCTTCTTACTCCTTACAAGATGGGGAACTTAAATCTTTCACACAGAATCGTTTTGGCGCCACTATTTAGAGCAAGATCTTACAACAACTTTGCTCAGCCGCATGCTATTCTATATTACTCTCAAAGAGCTACCAAGGGAGGTCTTCTGATTACTGAAGCTACTACTATTTCACCCACTTCTAAATTGTACGTAATTTGCATTTAA
>Glyma.04g184800.1.p sequence-type=predicted peptide transcript=Glyma.04g184800.1 locus=Glyma.04g184800 ID=Glyma.04g184800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MVEQKNQVIPLLTPYKMGNLNLSHRIVLAPLFRARSYNNFAQPHAILYYSQRATKGGLLITEATTISPTSKLYVICI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||