|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G64740.1 | AT | cellulose synthase 6 | JGI | N/A | IEA |
| GO:0009833 | GO-bp | plant-type primary cell wall biogenesis | EnsemblGenomes | N/A | IEA |
| GO:0030244 | GO-bp | cellulose biosynthetic process | EnsemblGenomes | N/A | IEA |
| GO:0030244 | GO-bp | cellulose biosynthetic process | JGI | N/A | IEA |
| GO:0071555 | GO-bp | cell wall organization | EnsemblGenomes | N/A | IEA |
| GO:0005794 | GO-cc | Golgi apparatus | EnsemblGenomes | N/A | IEA |
| GO:0005886 | GO-cc | plasma membrane | EnsemblGenomes | N/A | IEA |
| GO:0016020 | GO-cc | membrane | EnsemblGenomes | N/A | IEA |
| GO:0016020 | GO-cc | membrane | JGI | N/A | IEA |
| GO:0016021 | GO-cc | integral component of membrane | EnsemblGenomes | N/A | IEA |
| GO:0016740 | GO-mf | transferase activity | EnsemblGenomes | N/A | IEA |
| GO:0016757 | GO-mf | transferase activity, transferring glycosyl groups | EnsemblGenomes | N/A | IEA |
| GO:0016759 | GO-mf | cellulose synthase activity | EnsemblGenomes | N/A | IEA |
| GO:0016760 | GO-mf | cellulose synthase (UDP-forming) activity | EnsemblGenomes | N/A | IEA |
| GO:0016760 | GO-mf | cellulose synthase (UDP-forming) activity | JGI | N/A | IEA |
| PTHR13301 | Panther | X-BOX TRANSCRIPTION FACTOR-RELATED | JGI | N/A | IEA |
| PTHR13301:SF1 | Panther | JGI | N/A | IEA | |
| PF03552 | PFAM | Cellulose synthase | JGI | N/A | IEA |
| PWY-1001 | SoyCyc9 | cellulose biosynthesis | Plant Metabolic Network | ISS | |
| GN7V-63476 | SoyCyc9-rxn | cellulose synthase (UDP-forming) | Plant Metabolic Network | ISS |
|
Glyma.04G173700 not represented in the dataset |
Glyma.04G173700 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma04g34241 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.04g173700.1 sequence-type=CDS polypeptide=Glyma.04g173700.1.p locus=Glyma.04g173700 ID=Glyma.04g173700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGCTATGTACAATTTCCTCAAAGATTGATGGGATTGATCATCATGATAGATACTCAAATAAAAATATTGTATTCTTTGATATAAACATGAAAGGTTTAGATGGCATCCAAGGACCAATATATGTGGGAACTGGGTGTGCCTTTAGGTGGCAGGCGCTCTATGGATATGATGCCCCTGCTACGAAGAAACCACCAAGGAAACCTTGTAACTGTTGGCCCAAATGGTGCTACCTGTGTTGTGGATCTAGGAACAAGAATAGGAAAGTGAAGTCAGGTCCAAGAAAGAAGATAAAAAAATAA
>Glyma.04g173700.1.p sequence-type=predicted peptide transcript=Glyma.04g173700.1 locus=Glyma.04g173700 ID=Glyma.04g173700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MLCTISSKIDGIDHHDRYSNKNIVFFDINMKGLDGIQGPIYVGTGCAFRWQALYGYDAPATKKPPRKPCNCWPKWCYLCCGSRNKNRKVKSGPRKKIKK*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||