|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G07707.1 | AT | Plant mitochondrial ATPase, F0 complex, subunit 8 protein | JGI | N/A | IEA |
| GO:0015986 | GO-bp | ATP synthesis coupled proton transport | JGI | N/A | IEA |
| GO:0000276 | GO-cc | mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) | JGI | N/A | IEA |
| GO:0005739 | GO-cc | mitochondrion | EnsemblGenomes | N/A | IEA |
| GO:0016020 | GO-cc | membrane | EnsemblGenomes | N/A | IEA |
| GO:0016021 | GO-cc | integral component of membrane | EnsemblGenomes | N/A | IEA |
| GO:0015078 | GO-mf | hydrogen ion transmembrane transporter activity | JGI | N/A | IEA |
| PF02326 | PFAM | Plant ATP synthase F0 | JGI | N/A | IEA |
| PWY-7219 | SoyCyc9 | adenosine ribonucleotides de novo biosynthesis | Plant Metabolic Network | ISS | |
| PWY-7229 | SoyCyc9 | superpathway of adenosine nucleotides de novo biosynthesis I | Plant Metabolic Network | ISS | |
| PWY-841 | SoyCyc9 | superpathway of purine nucleotides de novo biosynthesis I | Plant Metabolic Network | ISS |
|
Glyma.04G145900 not represented in the dataset |
Glyma.04G145900 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma18g23174 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.04g145900.1 sequence-type=CDS polypeptide=Glyma.04g145900.1.p locus=Glyma.04g145900 ID=Glyma.04g145900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGTATGAGGTATCAAGAGTACAAAACAAAAGACTTGAAGTCTTGAAATATAATCATTGTTTCTCAATCAATCATGCCTCAATTGATAAATTCACTTATTTCACACAATTTTTCTGGTCATGCCTTTTCCTCTTTACTTTTTATATTCCCATCAAAGATGGAGATGGAGTACTTGGGATCAGTAGAATTCTAAAACAACCCAACCGACTGGTTTCAAACCGGGGGAACAAAAGAAGGAGAAATGACCCCAAGAGTTTGGAAGATATCTTTAGAAAAGGTTTTAGCACCGGTGTATCCTATTTGTACTCTAGTTTATTCGAAGTATCAAAATGGTGTAACGCCATCGACTCATTGGGAAAAAGGAGGAAAATCACTCTT
>Glyma.04g145900.1.p sequence-type=predicted peptide transcript=Glyma.04g145900.1 locus=Glyma.04g145900 ID=Glyma.04g145900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MYEVSRVQNKRLEVLKYNHCFSINHASIDKFTYFTQFFWSCLFLFTFYIPIKDGDGVLGISRILKQPNRLVSNRGNKRRRNDPKSLEDIFRKGFSTGVSYLYSSLFEVSKWCNAIDSLGKRRKITL
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||