|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G15802.1 | AT | heat shock factor binding protein | JGI | N/A | IEA |
| GO:1903507 | GO-bp | negative regulation of nucleic acid-templated transcription | EnsemblGenomes | N/A | IEA |
| GO:0003714 | GO-mf | transcription corepressor activity | EnsemblGenomes | N/A | IEA |
| PF06825 | PFAM | Heat shock factor binding protein 1 | JGI | N/A | IEA |
|
Glyma.03g213100 not represented in the dataset |
Glyma.03g213100 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma03g37121 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.03g213100.1 sequence-type=CDS polypeptide=Glyma.03g213100.1.p locus=Glyma.03g213100 ID=Glyma.03g213100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCATATTTACACAACAGCCCAGGTGGTTTATTATTTCTGCACACAGTTACATCTATAAACTCAAGACATCCACCTGTGCAAGTTGTCATATGTTGGCTAAGCCAGGATGGGCAACGATGCCAATTCTATTACATAATTATTGGTTCAAATTGCTCAAGTAATGTGTTTCTTGACATCGTCATTGCACTTGATGAGATGGGAGACCGTATAAATGAGTTGGAGCAAAGCATCAATGATTTAAGATCAGAGATGGGAGTGGAGAGCACTCCATCACCTGTGGCCCCTGCTAAGCCAAAGGAAGAAGAGTCAAACAAAGAAGAGGGTTCTGCTTGA
>Glyma.03g213100.1.p sequence-type=predicted peptide transcript=Glyma.03g213100.1 locus=Glyma.03g213100 ID=Glyma.03g213100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MAYLHNSPGGLLFLHTVTSINSRHPPVQVVICWLSQDGQRCQFYYIIIGSNCSSNVFLDIVIALDEMGDRINELEQSINDLRSEMGVESTPSPVAPAKPKEEESNKEEGSA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||