SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.03g195700

Feature Type:gene_model
Chromosome:Gm03
Start:40576339
stop:40579198
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.03g195700
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G52730.1AT ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein JGI N/AIEA
GO:0006122GO-bp mitochondrial electron transport, ubiquinol to cytochrome c EnsemblGenomesN/AIEA
GO:0006122GO-bp mitochondrial electron transport, ubiquinol to cytochrome c JGI N/AIEA
GO:0009060GO-bp aerobic respiration EnsemblGenomesN/AIEA
GO:0034551GO-bp mitochondrial respiratory chain complex III assembly EnsemblGenomesN/AIEA
GO:1902600GO-bp proton transmembrane transport EnsemblGenomesN/AIEA
GO:0005740GO-cc mitochondrial envelope JGI N/AIEA
GO:0005743GO-cc mitochondrial inner membrane EnsemblGenomesN/AIEA
GO:0005750GO-cc mitochondrial respiratory chain complex III EnsemblGenomesN/AIEA
GO:0005750GO-cc mitochondrial respiratory chain complex III JGI N/AIEA
GO:0008121GO-mf ubiquinol-cytochrome-c reductase activity EnsemblGenomesN/AIEA
KOG3494 KOG Ubiquinol cytochrome c oxidoreductase, subunit QCR9 JGI N/AIEA
PTHR12980Panther UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX, SUBUNIT X JGI N/AIEA
PF05365PFAM Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like JGI N/AIEA

Expression Patterns of Glyma.03g195700
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.03g195700 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma03g35340 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.03g195700
>Glyma.03g195700.1 sequence-type=CDS polypeptide=Glyma.03g195700.1.p locus=Glyma.03g195700 ID=Glyma.03g195700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGAAAGTGTTTCTCGAAGAAGAGGTGGAGGCATTTTCGAAAGCCTCTACAAGGTCGTTATGCGTCGCAACTCTGTCTATGTTACCTTTGTCATCGCTGGCGCCTTCCTTGGAGAACGGGCTGTTGATTATGGAGTCCACAAGCTCTGGGAGGCAAATAATGTTGGGAAACGATATGAAGACATTCCTGTGCTAGGGCAAAGGCCGTCAGAATAG
Predicted protein sequences of Glyma.03g195700
>Glyma.03g195700.1.p sequence-type=predicted peptide transcript=Glyma.03g195700.1 locus=Glyma.03g195700 ID=Glyma.03g195700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MESVSRRRGGGIFESLYKVVMRRNSVYVTFVIAGAFLGERAVDYGVHKLWEANNVGKRYEDIPVLGQRPSE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo