SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.03g180900

Feature Type:gene_model
Chromosome:Gm03
Start:39267448
stop:39269246
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.03g180900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G53420.1AT plasma membrane intrinsic protein 2A JGI N/AIEA
GO:0006810GO-bp transport JGI N/AIEA
GO:0006833GO-bp water transport EnsemblGenomesN/AIEA
GO:0034220GO-bp ion transmembrane transport EnsemblGenomesN/AIEA
GO:0055085GO-bp transmembrane transport EnsemblGenomesN/AIEA
GO:0005887GO-cc integral component of plasma membrane EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane JGI N/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0005215GO-mf transporter activity EnsemblGenomesN/AIEA
GO:0005215GO-mf transporter activity JGI N/AIEA
GO:0015250GO-mf water channel activity EnsemblGenomesN/AIEA
GO:0015267GO-mf channel activity EnsemblGenomesN/AIEA
KOG0223 KOG Aquaporin (major intrinsic protein family) JGI N/AIEA
PTHR19139Panther AQUAPORIN TRANSPORTER JGI N/AIEA
PTHR19139:SF27Panther JGI N/AIEA
PF00230PFAM Major intrinsic protein JGI N/AIEA

Proteins Associated with Glyma.03g180900
LocusGene SymbolProtein Name
PIP2-7 aquaporin PIP2-7

Expression Patterns of Glyma.03g180900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.03g180900 not represented in the dataset
Glyma.03g180900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.03g180900
ParalogEvidenceComments
Glyma.19g181300 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.03g180900 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma03g33803 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.03g180900
>Glyma.03g180900.1 sequence-type=CDS polypeptide=Glyma.03g180900.1.p locus=Glyma.03g180900 ID=Glyma.03g180900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCGAAAGACATCGAAACTGAGGTCCAAAGTGGGCTGCCACACAAGGACTACCACGACCCACCCGCCGCCGCATTCTACGACCCCGCCGAGCTCCGCAAGTGGTCCTTCTACCGCGCCCTCATCGCCGAGTTTGTCGCCACTCTCCTCTTCCTCTACGTCACCATCCTCACCGTCATCGGCTACAATCACCAGACCGCCACCGGCAGCCCCGACCTCTGCAATGGCGTCGGCGTCCTCGGCATCGCTTGGGCCTTCGGAGGCATGATATTTGTCCTTGTCTATTGCACTGCTGGGATATCAGGGGGACACATAAACCCGGCGGTAACGTTTGGGTTGTTTCTGGCGAGGAAGGTGTCGCTTATAAGAGCAGTTGGGTACATGGTGGCTCAGGTGTTGGGGGCCATAAGTGGTGTGGGGCTAGTGAAGGCTTTACAGAAGAGCTACTACAACAGGTACAATGGTGGCGTGAACATGCTCGCTGATGGGTACAGCAAAGGAACCGGTTTGGGAGCTGAGATTATTGGCACATTTATTCTTGTCTACACCGTCTTCTCTGCTACCGATCCCAAGAGAGTGGCAAGAGACTCCCATGTTCCCGTGTTGGCACCACTTCCAATTGGGTTTGCGGTGTTCATAGTTCACCTGGCCACCATCCCTATCACCGGCACTGGCATCAACCCAGCCAGAAGCCTAGGGCCTGCTGTCATATTCAACAACGAGAAGGCATGGGATGACCAGTGGATCTTCTGGGTTGGACCCTTCATCGGTGCTGCCATTGCTGCATTCTACCACCAGTCCGTGCTGAGGGCCCAAGCAGCAAAGGCTCTCGGGTCTTTCAGGAGCTCCTCAAACCTGTAA
Predicted protein sequences of Glyma.03g180900
>Glyma.03g180900.1.p sequence-type=predicted peptide transcript=Glyma.03g180900.1 locus=Glyma.03g180900 ID=Glyma.03g180900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAKDIETEVQSGLPHKDYHDPPAAAFYDPAELRKWSFYRALIAEFVATLLFLYVTILTVIGYNHQTATGSPDLCNGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVGYMVAQVLGAISGVGLVKALQKSYYNRYNGGVNMLADGYSKGTGLGAEIIGTFILVYTVFSATDPKRVARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGPAVIFNNEKAWDDQWIFWVGPFIGAAIAAFYHQSVLRAQAAKALGSFRSSSNL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo