SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.03g180700

Feature Type:gene_model
Chromosome:Gm03
Start:39261462
stop:39263776
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.03g180700
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G01390.1AT vacuolar membrane ATPase 10 JGI N/AIEA
GO:0006811GO-bp ion transport EnsemblGenomesN/AIEA
GO:0055085GO-bp transmembrane transport EnsemblGenomesN/AIEA
GO:1902600GO-bp proton transmembrane transport EnsemblGenomesN/AIEA
GO:0016471GO-cc vacuolar proton-transporting V-type ATPase complex EnsemblGenomesN/AIEA
GO:0042626GO-mf ATPase activity, coupled to transmembrane movement of substances EnsemblGenomesN/AIEA
KOG1772 KOG Vacuolar H+-ATPase V1 sector, subunit G JGI N/AIEA
PTHR12713Panther VACUOLAR ATP SYNTHASE SUBUNIT G JGI N/AIEA
PTHR12713:SF1Panther JGI N/AIEA
PF03179PFAM Vacuolar (H+)-ATPase G subunit JGI N/AIEA
PWY-7219SoyCyc9 adenosine ribonucleotides de novo biosynthesis Plant Metabolic Network ISS
PWY-7229SoyCyc9 superpathway of adenosine nucleotides de novo biosynthesis I Plant Metabolic Network ISS
PWY-841SoyCyc9 superpathway of purine nucleotides de novo biosynthesis I Plant Metabolic Network ISS

Expression Patterns of Glyma.03g180700
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.03g180700 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma03g33790 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.03g180700
>Glyma.03g180700.1 sequence-type=CDS polypeptide=Glyma.03g180700.1.p locus=Glyma.03g180700 ID=Glyma.03g180700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCATCCAACAGGGGTCAAGGTGGAATTCAACAGTTGCTGGCTGCTGAACAAGAAGCGCAAAGAATTGTCAATGCTGCAAAAAATGAAAAATTGGCTAGACTGAAGCAAGCCAAAGAAGAGGCTGAAAAGGAAATTGCCGAGTATAGGGCTCAGTTGGAGTACGAGTTTCAAAAGAAAGTGTCACAGAGTAGTGGAGATTCTGGTGCTAATGTGAAGAGACTTGAGCAAGAGACAGAAGAAAAGATTCATCACCTGAAAACTGAGGCTGAGAGGATATCAGGGGATGTTGTCTCCATGCTCCTCAAGCATGTAACAAGTGTGAAGAATTAG
Predicted protein sequences of Glyma.03g180700
>Glyma.03g180700.1.p sequence-type=predicted peptide transcript=Glyma.03g180700.1 locus=Glyma.03g180700 ID=Glyma.03g180700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MASNRGQGGIQQLLAAEQEAQRIVNAAKNEKLARLKQAKEEAEKEIAEYRAQLEYEFQKKVSQSSGDSGANVKRLEQETEEKIHHLKTEAERISGDVVSMLLKHVTSVKN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo