|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G25940.1 | AT | TFIIB zinc-binding protein | JGI | N/A | IEA |
GO:0006351 | GO-bp | transcription, DNA-templated | EnsemblGenomes | N/A | IEA |
GO:0006351 | GO-bp | transcription, DNA-templated | JGI | N/A | IEA |
GO:0006363 | GO-bp | termination of RNA polymerase I transcription | EnsemblGenomes | N/A | IEA |
GO:0006379 | GO-bp | mRNA cleavage | EnsemblGenomes | N/A | IEA |
GO:0005634 | GO-cc | nucleus | EnsemblGenomes | N/A | IEA |
GO:0005730 | GO-cc | nucleolus | EnsemblGenomes | N/A | IEA |
GO:0005736 | GO-cc | DNA-directed RNA polymerase I complex | EnsemblGenomes | N/A | IEA |
GO:0001054 | GO-mf | RNA polymerase I activity | EnsemblGenomes | N/A | IEA |
GO:0003676 | GO-mf | nucleic acid binding | EnsemblGenomes | N/A | IEA |
GO:0003676 | GO-mf | nucleic acid binding | JGI | N/A | IEA |
GO:0003899 | GO-mf | DNA-directed 5'-3' RNA polymerase activity | EnsemblGenomes | N/A | IEA |
GO:0008270 | GO-mf | zinc ion binding | EnsemblGenomes | N/A | IEA |
GO:0008270 | GO-mf | zinc ion binding | JGI | N/A | IEA |
GO:0046872 | GO-mf | metal ion binding | EnsemblGenomes | N/A | IEA |
KOG2907 | KOG | RNA polymerase I transcription factor TFIIS, subunit A12.2/RPA12 | JGI | N/A | IEA |
PTHR11239 | Panther | DNA-DIRECTED RNA POLYMERASE | JGI | N/A | IEA |
PTHR11239:SF3 | Panther | JGI | N/A | IEA | |
PF01096 | PFAM | Transcription factor S-II (TFIIS) | JGI | N/A | IEA |
Glyma.03g178900 not represented in the dataset |
Glyma.03g178900 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Paralog | Evidence | Comments |
---|---|---|
Glyma.19g179600 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma03g33630 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.03g178900.1 sequence-type=CDS polypeptide=Glyma.03g178900.1.p locus=Glyma.03g178900 ID=Glyma.03g178900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCTTCTTCTCGGCTCGATTTCTTGTTCTGTAATTTGTGTGGGACAATGCTCACTGTCCCTTCCACTGAGTACGCACAATGCCCACTGTGCAAAACTCGCCGAGACATACAAGATATTTGTGATAAGGAAATAAGTTTCACAATTTCTGATGAGGATATCAGAAGAGAGCTTGGAATGGAAATAATTGAGGAACATGCGGTGATGGAATATTCTAAGGTCAGCAAGAAATGTGAAAAATGTGGCCATGGTGAAGCTACCTATTATACTAGACAGATGAGATCAGCAGATGAAGGGCAAACTACTTTCTACACATGTACCGGCTGTGGTCATCAATCTCAGGAGAATTAG
>Glyma.03g178900.1.p sequence-type=predicted peptide transcript=Glyma.03g178900.1 locus=Glyma.03g178900 ID=Glyma.03g178900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MASSRLDFLFCNLCGTMLTVPSTEYAQCPLCKTRRDIQDICDKEISFTISDEDIRRELGMEIIEEHAVMEYSKVSKKCEKCGHGEATYYTRQMRSADEGQTTFYTCTGCGHQSQEN*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||