Report for Sequence Feature Glyma.03g166600
| Feature Type: | gene_model |
| Chromosome: | Gm03 |
| Start: | 39287950 |
| stop: | 39288177 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.03g166600
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| PTHR34538 | PantherFam |
EXPRESSED PROTEIN |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.03g166600 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma03g32371 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.03g166600
>Glyma.03g166600.1 sequence-type=CDS polypeptide=Glyma.03g166600.1.p locus=Glyma.03g166600 id=Glyma.03g166600.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGAGAGTTAGCCCTTTAGTGACACTTGGTAATGTTCCAAGAAGGAGCTTACTTGGCTATGGCCCTTCATCAAGCGTTCTGAGACAGCTAGTTTGCAAGTTGAAGCGTGGCTGGAAGCAAACCATGGGATGGCGCAAGAGAGGTCCACAATACAGCTATGATTTTCACAGTTATTGTCTTAACTTCAGTGATGGTCCTTCAAACGACCATTTCCATATCCCTCCTTAA
Predicted protein sequences of Glyma.03g166600
>Glyma.03g166600.1.p sequence-type=predicted peptide transcript=Glyma.03g166600.1 locus=Glyma.03g166600 id=Glyma.03g166600.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MRVSPLVTLGNVPRRSLLGYGPSSSVLRQLVCKLKRGWKQTMGWRKRGPQYSYDFHSYCLNFSDGPSNDHFHIPP*