SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.03g118100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.03g118100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.03g118100

Feature Type:gene_model
Chromosome:Gm03
Start:32835245
stop:32836705
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G45050.1AT GATA transcription factor 2 JGI N/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated JGI N/AIEA
GO:0006366GO-bp transcription by RNA polymerase II EnsemblGenomesN/AIEA
GO:0030154GO-bp cell differentiation EnsemblGenomesN/AIEA
GO:0045944GO-bp positive regulation of transcription by RNA polymerase II EnsemblGenomesN/AIEA
GO:0005634GO-cc nucleus EnsemblGenomesN/AIEA
GO:0005667GO-cc transcription factor complex EnsemblGenomesN/AIEA
GO:0000977GO-mf RNA polymerase II regulatory region sequence-specific DNA binding EnsemblGenomesN/AIEA
GO:0001085GO-mf RNA polymerase II transcription factor binding EnsemblGenomesN/AIEA
GO:0001228GO-mf transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific DNA binding EnsemblGenomesN/AIEA
GO:0003682GO-mf chromatin binding EnsemblGenomesN/AIEA
GO:0003700GO-mf DNA binding transcription factor activity EnsemblGenomesN/AIEA
GO:0003700GO-mf sequence-specific DNA binding transcription factor activity JGI N/AIEA
GO:0008270GO-mf zinc ion binding EnsemblGenomesN/AIEA
GO:0008270GO-mf zinc ion binding JGI N/AIEA
GO:0043565GO-mf sequence-specific DNA binding EnsemblGenomesN/AIEA
GO:0043565GO-mf sequence-specific DNA binding JGI N/AIEA
GO:0046872GO-mf metal ion binding EnsemblGenomesN/AIEA
PTHR10071Panther TRANSCRIPTION FACTOR GATA (GATA BINDING FACTOR) JGI N/AIEA
PTHR10071:SF113Panther JGI N/AIEA
PF00320PFAM GATA zinc finger JGI N/AIEA

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.03g118100 not represented in the dataset

Glyma.03g118100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.07g108900 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Corresponding NameAnnotation VersionEvidenceComments
Glyma03g27250 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.03g118100.1 sequence-type=CDS polypeptide=Glyma.03g118100.1.p locus=Glyma.03g118100 ID=Glyma.03g118100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGACTTGTACGGTTCCTTTTCCACCCCTTCAGATTGCTTACACATCGATGATTTTCTAGATTTCTCCAACATCACCACCACCACCACCGACACCCACCACCACTTTCCTCCGCCGCAAAACTCTCCATCAATCTCCCACGATCCCAATTTCTTCCTCAATTTCCCTTCCGTTCCGAGCGACGAAGCAGTGGAGCTGGAGTGGCTCTCCCAGTTCGTGAACGACGAGGCGACGTCGTTTCACAACATCCCACCACCCGCATCCATTGGATCCCACACGACGCCGTTTCTTTCCAACAATAACAGGAACGATAATAATAACGAATATCCCAAATCATCATCATCTTCACCGGTGTTGGCGGGAAAATCGAGAGCAAGAAGGGAAGGGTCGGTGACCGGCGACGGCGTGCGGCGCTGCAGCCACTGTGCGACGGATAAGACCCCGCAGTGGCGCACGGGACCGTTGGGGCCGAAGACGCTCTGCAACGCGTGCGGCGTGCGGTTCAAGTCGGGTCGGCTCGTACCCGAATACCGACCCGCCGCGAGCCCTACGTTCGTGATGACTCAGCACTCGAACTCGCACCGCAAGGTTATGGAGCTCCGTCGCCAGAAGGAGCTGCTCCGCCACCAGCAGCAAGAACAATGCTACCGTCACACTCACCACGACTTCAAAGTCTGCTGA

>Glyma.03g118100.1.p sequence-type=predicted peptide transcript=Glyma.03g118100.1 locus=Glyma.03g118100 ID=Glyma.03g118100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MDLYGSFSTPSDCLHIDDFLDFSNITTTTTDTHHHFPPPQNSPSISHDPNFFLNFPSVPSDEAVELEWLSQFVNDEATSFHNIPPPASIGSHTTPFLSNNNRNDNNNEYPKSSSSSPVLAGKSRARREGSVTGDGVRRCSHCATDKTPQWRTGPLGPKTLCNACGVRFKSGRLVPEYRPAASPTFVMTQHSNSHRKVMELRRQKELLRHQQQEQCYRHTHHDFKVC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo