|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G01710.1 | AT | ARP2/3 complex 16 kDa subunit (p16-Arc) | JGI | N/A | IEA |
| GO:0030833 | GO-bp | regulation of actin filament polymerization | EnsemblGenomes | N/A | IEA |
| GO:0030833 | GO-bp | regulation of actin filament polymerization | JGI | N/A | IEA |
| GO:0034314 | GO-bp | Arp2/3 complex-mediated actin nucleation | EnsemblGenomes | N/A | IEA |
| GO:0005737 | GO-cc | cytoplasm | EnsemblGenomes | N/A | IEA |
| GO:0005856 | GO-cc | cytoskeleton | EnsemblGenomes | N/A | IEA |
| GO:0005856 | GO-cc | cytoskeleton | JGI | N/A | IEA |
| GO:0005885 | GO-cc | Arp2/3 protein complex | EnsemblGenomes | N/A | IEA |
| GO:0015629 | GO-cc | actin cytoskeleton | EnsemblGenomes | N/A | IEA |
| GO:0051015 | GO-mf | actin filament binding | EnsemblGenomes | N/A | IEA |
| KOG3380 | KOG | Actin-related protein Arp2/3 complex, subunit ARPC5 | JGI | N/A | IEA |
| PTHR12644 | Panther | ARP2/3 COMPLEX 16 KD SUBUNIT (P16-ARC) | JGI | N/A | IEA |
| PF04699 | PFAM | ARP2/3 complex 16 kDa subunit (p16-Arc) | JGI | N/A | IEA |
|
Glyma.03g114200 not represented in the dataset |
Glyma.03g114200 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.07g112500 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma03g26690 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.03g114200.1 sequence-type=CDS polypeptide=Glyma.03g114200.1.p locus=Glyma.03g114200 ID=Glyma.03g114200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCAGGAGCAAAAGGGTTCGTTGAAGCAGATAATGCAGAGGCCATAATTACCAGAATTGAACACAAATCGCGAAAGATCGAAACTTTGCTCAAACAGTATAAGCCCGTGGAAGCCCTTAAAACTGCCCTTGAAGGCACATTTGCCATCATTGGGGATGAGCGTTGCAAGTCGGCACACTGGCTTGTGGTGCACAGAGCTATAATGGCTATAAAAGATGTGGATGGGATGCTTTCTTCCTTGGATCCTGAGTACTATGATATCCTAATGAAGTACTTGTATAGAGGCTTAGCTACCGGAGATCGCCCGACCTGTGACCAATGTCTTCTGATTCATGAAAAATTGACAGAGAAAGCAGGACTAGGTTGCATCCTACGTTTCCTCACAGATATTGTAAATACAGTTTGA
>Glyma.03g114200.1.p sequence-type=predicted peptide transcript=Glyma.03g114200.1 locus=Glyma.03g114200 ID=Glyma.03g114200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MAGAKGFVEADNAEAIITRIEHKSRKIETLLKQYKPVEALKTALEGTFAIIGDERCKSAHWLVVHRAIMAIKDVDGMLSSLDPEYYDILMKYLYRGLATGDRPTCDQCLLIHEKLTEKAGLGCILRFLTDIVNTV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||