Glyma.03g103600

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.03g103600): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.03g103600): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.03g103600

Feature Type:	gene_model
Chromosome:	Gm03
Start:	29762718
stop:	29766420
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.03g103600

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G60210.1	AT	GroES-like family protein	JGI	N/A	IEA
GO:0006457	GO-bp	protein folding	EnsemblGenomes	N/A	IEA
GO:0006457	GO-bp	protein folding	JGI	N/A	IEA
GO:0006986	GO-bp	response to unfolded protein	EnsemblGenomes	N/A	IEA
GO:0051085	GO-bp	chaperone cofactor-dependent protein refolding	EnsemblGenomes	N/A	IEA
GO:0005737	GO-cc	cytoplasm	EnsemblGenomes	N/A	IEA
GO:0005737	GO-cc	cytoplasm	JGI	N/A	IEA
GO:0005759	GO-cc	mitochondrial matrix	EnsemblGenomes	N/A	IEA
GO:0009507	GO-cc	chloroplast	EnsemblGenomes	N/A	IEA
GO:0046872	GO-mf	metal ion binding	EnsemblGenomes	N/A	IEA
GO:0051082	GO-mf	unfolded protein binding	EnsemblGenomes	N/A	IEA
GO:0051087	GO-mf	chaperone binding	EnsemblGenomes	N/A	IEA
KOG1641	KOG	Mitochondrial chaperonin	JGI	N/A	IEA
PTHR10772	Panther	10 KDA HEAT SHOCK PROTEIN	JGI	N/A	IEA
PTHR10772:SF0	Panther	20 KDA CHAPERONIN, CHLOROPLASTIC	JGI	N/A	IEA
PF00166	PFAM	Chaperonin 10 Kd subunit	JGI	N/A	IEA

Expression Patterns of Glyma.03g103600

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.03g103600 not represented in the dataset	Glyma.03g103600 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.03g103600

Paralog	Evidence	Comments
Glyma.07g120400	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.03g103600 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma03g24900	Wm82.a1.v1.1	IGC	As supplied by JGI

Transcripts of Glyma.03g103600

Limit To All Plant Sequences

>Glyma.03g103600.2 sequence-type=transcript locus=Glyma.03g103600 ID=Glyma.03g103600.2.Wm82.a2.v1 annot-version=Wm82.a2.v1
AGGTTCCAGTAGTTTCTCAAATCTTCTACATACATTTTTTTTGGCACCCACTTTGTCTTTTCTTTGGCCTTTAGCAACACTATAGATAAACCTAATAATAAGAGGGTTTAACCTCTTTTCCTTAATCCATTCATTGCTCCCTCGAACTGTTGTTTGGTCTCTTCTCTCTTATCCATGGCATCAACGTTTCTCACCCTACCAACTCCCTTCCTACACAAAACCAATGCCATCAGTTTCTCTAACAAGAGACCCTCATTTTTGCAGAGGAGCTCTCTGAAGATTCATGCAATTACCAAAAAATGGGAACCCACAAAGGTTGTGCCTCAGGCTGATAGAGTTCTTATTCGTTTGGAGGAGCTTTCAGATAAAACAGTTGGTGGAGTTTTGCTGCCTAAATCAGCTGTTAAATTTGAGCGCTATCTTGTGGGAGAAATCCTAACTGTTGGTGCTGAGGCTGGAGAACTAAAGGCTGGAACAAAGGTACTAGTTTAACTACCGTGA

Coding sequences of Glyma.03g103600

Limit To All Plant Sequences

>Glyma.03g103600.1 sequence-type=CDS polypeptide=Glyma.03g103600.1.p locus=Glyma.03g103600 ID=Glyma.03g103600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCATCAACGTTTCTCACCCTACCAACTCCCTTCCTACACAAAACCAATGCCATCAGTTTCTCTAACAAGAGACCCTCATTTTTGCAGAGGAGCTCTCTGAAGATTCATGCAATTACCAAAAAATGGGAACCCACAAAGGTTGTGCCTCAGGCTGATAGAGTTCTTATTCGTTTGGAGGAGCTTTCAGATAAAACAGTTGGTGGAGTTTTGCTGCCTAAATCAGCTGTTAAATTTGAGCGCTATCTTGTGGGAGAAATCCTAACTGTTGGTGCTGAGGCTGGAGAACTAAAGGCTGGAACAAAGGTACTATTCACTGACATGAATGCTTATGAGGTGGATTTGGGGACTGATGCAAAACACTGCTTCTGTAAAGCAAGTGACTTATTGGCCGTTGTGGAGTAG

>Glyma.03g103600.2 sequence-type=CDS polypeptide=Glyma.03g103600.2.p locus=Glyma.03g103600 ID=Glyma.03g103600.2.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCATCAACGTTTCTCACCCTACCAACTCCCTTCCTACACAAAACCAATGCCATCAGTTTCTCTAACAAGAGACCCTCATTTTTGCAGAGGAGCTCTCTGAAGATTCATGCAATTACCAAAAAATGGGAACCCACAAAGGTTGTGCCTCAGGCTGATAGAGTTCTTATTCGTTTGGAGGAGCTTTCAGATAAAACAGTTGGTGGAGTTTTGCTGCCTAAATCAGCTGTTAAATTTGAGCGCTATCTTGTGGGAGAAATCCTAACTGTTGGTGCTGAGGCTGGAGAACTAAAGGCTGGAACAAAGGTACTAGTTTAA

Predicted protein sequences of Glyma.03g103600

Limit To All Plant Sequences

>Glyma.03g103600.1.p sequence-type=predicted peptide transcript=Glyma.03g103600.1 locus=Glyma.03g103600 ID=Glyma.03g103600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MASTFLTLPTPFLHKTNAISFSNKRPSFLQRSSLKIHAITKKWEPTKVVPQADRVLIRLEELSDKTVGGVLLPKSAVKFERYLVGEILTVGAEAGELKAGTKVLFTDMNAYEVDLGTDAKHCFCKASDLLAVVE*

>Glyma.03g103600.2.p sequence-type=predicted peptide transcript=Glyma.03g103600.2 locus=Glyma.03g103600 ID=Glyma.03g103600.2.Wm82.a2.v1 annot-version=Wm82.a2.v1
MASTFLTLPTPFLHKTNAISFSNKRPSFLQRSSLKIHAITKKWEPTKVVPQADRVLIRLEELSDKTVGGVLLPKSAVKFERYLVGEILTVGAEAGELKAGTKVLV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain