|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G33120.1 | AT | S-adenosyl-L-methionine-dependent methyltransferases superfamily protein | JGI | N/A | IEA |
| GO:0006364 | GO-bp | rRNA processing | JGI | N/A | IEA |
| GO:0006400 | GO-bp | tRNA modification | JGI | N/A | IEA |
| GO:0006464 | GO-bp | cellular protein modification process | JGI | N/A | IEA |
| GO:0008152 | GO-bp | metabolic process | JGI | N/A | IEA |
| GO:0008610 | GO-bp | lipid biosynthetic process | JGI | N/A | IEA |
| GO:0005737 | GO-cc | cytoplasm | JGI | N/A | IEA |
| GO:0004719 | GO-mf | protein-L-isoaspartate (D-aspartate) O-methyltransferase activity | JGI | N/A | IEA |
| GO:0008168 | GO-mf | methyltransferase activity | JGI | N/A | IEA |
| GO:0008176 | GO-mf | tRNA (guanine-N7-)-methyltransferase activity | JGI | N/A | IEA |
| GO:0008649 | GO-mf | rRNA methyltransferase activity | JGI | N/A | IEA |
| PTHR10108 | Panther | METHYLTRANSFERASE | JGI | N/A | IEA |
| PTHR10108:SF301 | Panther | JGI | N/A | IEA | |
| PF02353 | PFAM | Mycolic acid cyclopropane synthetase | JGI | N/A | IEA |
| GN7V-48149 | SoyCyc9-rxn | (S)-coclaurine-N-methyltransferase | Plant Metabolic Network | ISS |
|
Glyma.03g095400 not represented in the dataset |
Glyma.03g095400 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma03g23554 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.03g095400.1 sequence-type=CDS polypeptide=Glyma.03g095400.1.p locus=Glyma.03g095400 ID=Glyma.03g095400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGTTGAAATTGTGCTGCGAGAGATCAAATTTGAAAGACGGTTATACAGTACTTGATTTGGGATGCGGTTGGGGATCGCTGGTTTTGTACATTGCCAAGAATTACACTAACTGTAGGGTTATTGGAAGCAGCTATTCGACAACTCAAAAGACTTATATTGAGGAGAAGTGCCGAGATCTTCAGCTGCAAAATTTGAATATTATAGTTGCTGATATTGGCACATTTGAAATGGAGGCTTCTTACGACATAATATTTTCCATAGAAATGTTTGAGCATATGAAGAACTATAAAGATCTTCTCAAGAAGATATCCAAATGGATGAAAGAGGATAGCCTTTTATTTGTTCATATCATGTGCCACAAAGCATATCCTTAA
>Glyma.03g095400.1.p sequence-type=predicted peptide transcript=Glyma.03g095400.1 locus=Glyma.03g095400 ID=Glyma.03g095400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MLKLCCERSNLKDGYTVLDLGCGWGSLVLYIAKNYTNCRVIGSSYSTTQKTYIEEKCRDLQLQNLNIIVADIGTFEMEASYDIIFSIEMFEHMKNYKDLLKKISKWMKEDSLLFVHIMCHKAYP*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||