|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
ATMG01360.1 | AT | cytochrome oxidase | JGI | N/A | IEA |
GO:0006119 | GO-bp | oxidative phosphorylation | EnsemblGenomes | N/A | IEA |
GO:0006123 | GO-bp | mitochondrial electron transport, cytochrome c to oxygen | EnsemblGenomes | N/A | IEA |
GO:0009060 | GO-bp | aerobic respiration | EnsemblGenomes | N/A | IEA |
GO:0009060 | GO-bp | aerobic respiration | JGI | N/A | IEA |
GO:0015990 | GO-bp | electron transport coupled proton transport | EnsemblGenomes | N/A | IEA |
GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
GO:0055114 | GO-bp | oxidation-reduction process | JGI | N/A | IEA |
GO:0005739 | GO-cc | mitochondrion | EnsemblGenomes | N/A | IEA |
GO:0005743 | GO-cc | mitochondrial inner membrane | EnsemblGenomes | N/A | IEA |
GO:0005751 | GO-cc | mitochondrial respiratory chain complex IV | EnsemblGenomes | N/A | IEA |
GO:0016020 | GO-cc | membrane | EnsemblGenomes | N/A | IEA |
GO:0016021 | GO-cc | integral component of membrane | EnsemblGenomes | N/A | IEA |
GO:0016021 | GO-cc | integral component of membrane | JGI | N/A | IEA |
GO:0045277 | GO-cc | respiratory chain complex IV | EnsemblGenomes | N/A | IEA |
GO:0070469 | GO-cc | respiratory chain | EnsemblGenomes | N/A | IEA |
GO:0004129 | GO-mf | cytochrome-c oxidase activity | EnsemblGenomes | N/A | IEA |
GO:0004129 | GO-mf | cytochrome-c oxidase activity | JGI | N/A | IEA |
GO:0005506 | GO-mf | iron ion binding | EnsemblGenomes | N/A | IEA |
GO:0005506 | GO-mf | iron ion binding | JGI | N/A | IEA |
GO:0009055 | GO-mf | electron transfer activity | EnsemblGenomes | N/A | IEA |
GO:0009055 | GO-mf | electron carrier activity | JGI | N/A | IEA |
GO:0016491 | GO-mf | oxidoreductase activity | EnsemblGenomes | N/A | IEA |
GO:0020037 | GO-mf | heme binding | EnsemblGenomes | N/A | IEA |
GO:0020037 | GO-mf | heme binding | JGI | N/A | IEA |
GO:0046872 | GO-mf | metal ion binding | EnsemblGenomes | N/A | IEA |
PTHR10422 | Panther | CYTOCHROME C OXIDASE SUBUNIT 1 | JGI | N/A | IEA |
PF00115 | PFAM | Cytochrome C and Quinol oxidase polypeptide I | JGI | N/A | IEA |
PWY-3781 | SoyCyc9 | aerobic respiration I (cytochrome c) | Plant Metabolic Network | ISS | |
GN7V-52361 | SoyCyc9-rxn | cytochrome-c oxidase | Plant Metabolic Network | ISS |
Glyma.03g094400 not represented in the dataset |
Glyma.03g094400 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma03g23306 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.03g094400.1 sequence-type=CDS polypeptide=Glyma.03g094400.1.p locus=Glyma.03g094400 ID=Glyma.03g094400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGTTATTAACCGATCAAAACTTTAATACAACCTTTTCTGATCCCGCAGGAGGGGGAGACCCCATCTTATACCAGCATCTCTTTCGGTTCTTCGGTCATCCAGAGGTGTATATTCCCATTCTGCCTGGATCCGGTATCATGAGTCATATTGTTTTGACTTTTTCGGGAAAACCGGTCTTCGGGTATCTAGGCATGGTTTATGCCATGATCAGTATAGGTGTTCTTGGATTTCTTGTTTGGAGTAAACCAGAAAAATATAGGTAA
>Glyma.03g094400.1.p sequence-type=predicted peptide transcript=Glyma.03g094400.1 locus=Glyma.03g094400 ID=Glyma.03g094400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MLLTDQNFNTTFSDPAGGGDPILYQHLFRFFGHPEVYIPILPGSGIMSHIVLTFSGKPVFGYLGMVYAMISIGVLGFLVWSKPEKYR*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||