Report for Sequence Feature Glyma.03g076600
Feature Type: gene_model
Chromosome: Gm03
Start: 18953669
stop: 18966060
Source: JGI
Version: Wm82.a2.v1
High confidence: yes
A previous version of this gene model can be found here:
Annotations for Glyma.03g076600
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G38025.1 AT
Cysteine proteinases superfamily protein
JGI N/A IEA
GO:0016579 GO-bp
protein deubiquitination
EnsemblGenomes N/A IEA
GO:0030433 GO-bp
ubiquitin-dependent ERAD pathway
EnsemblGenomes N/A IEA
GO:0030968 GO-bp
endoplasmic reticulum unfolded protein response
EnsemblGenomes N/A IEA
GO:1904153 GO-bp
negative regulation of retrograde protein transport, ER to cytosol
EnsemblGenomes N/A IEA
GO:0005634 GO-cc
nucleus
EnsemblGenomes N/A IEA
GO:0005829 GO-cc
cytosol
EnsemblGenomes N/A IEA
GO:0004843 GO-mf
thiol-dependent ubiquitin-specific protease activity
EnsemblGenomes N/A IEA
GO:1904265 GO-mf
ubiquitin-specific protease activity involved in negative regulation of retrograde protein transport, ER to cytosol
EnsemblGenomes N/A IEA
PTHR13312 Panther
HIV-INDUCED PROTEIN-7-LIKE PROTEASE
JGI N/A IEA
PF02338 PFAM
OTU-like cysteine protease
JGI N/A IEA
Expression Patterns of Glyma.03g076600
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Related Legume Genes
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS .
Gene information in GlycineMine developed by LIS .
Related Plant Genes
Gene families from PhyloGenes .
Paralogs of Glyma.03g076600
Paralog Evidence Comments
Glyma.01g111000 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.
Gene model name correspondences to Glyma.03g076600 Gene Call Version Wm82.a2.v1
Corresponding Name Annotation Version Evidence Comments
Glyma03g14730 Wm82.a1.v1.1 IGC As supplied by JGI
Coding sequences of Glyma.03g076600
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma.03g076600.1 sequence-type=CDS polypeptide=Glyma.03g076600.1.p locus=Glyma.03g076600 ID=Glyma.03g076600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTCGCAAGCCTTTCAAATTCAATGAGGATGTTCTCGAGCAACTTAGAAATGGGACTGCGAAATTCGAGGTTGTTTCTTCCCCGGTTCCTTCAGTTGCTGCTCCTCCTAACCGGAACACGAGCTTGTTTGGGATTGGGAATAGTAGCACTGTCTTATTCGCCAGAATTGGCTCATCCTTTGGTGGACACTCTCCAGCAATGAAGAAACTTGAGCATTTTTCAGTTCAGAAGGTTACAGGGGATGGACGGTGTCTGTTTCGTGCACTGGTCAAAGGAATGGCTTACAATAAGGGAACCACTCTCAATCAACGCGAGGAGAGAGAAAATGCAGATGAATTAAGAATGGCTGTGAAAGAAGCTATATGTGAAAATGAAGGTGAACGTAAATTATACGAAGAAGCCCTCATTGCCATCACAGTTGACGAGCCTATAAAACGTTACTGCCAGCGGATTGTGCGACCTGATTTCTGGGGAGGAGAATCAGAGCTATTGGTACTGTCAAAGTTATGTAAGCAGCCAATCATTGTGTACATACCAGAGCATGAGCATAGAAGTGGTGGTTTTGGATCTGGTTTCATTCCCATTGCAGAGTATGGAAGTGACTTTAGAAAGGGTTCTAGCAGAAAAGCTGTGAGGCTATTATACAGCGGTAAGAACCATTATGATCTTCTAGTATGA
Predicted protein sequences of Glyma.03g076600
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma.03g076600.1.p sequence-type=predicted peptide transcript=Glyma.03g076600.1 locus=Glyma.03g076600 ID=Glyma.03g076600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MARKPFKFNEDVLEQLRNGTAKFEVVSSPVPSVAAPPNRNTSLFGIGNSSTVLFARIGSSFGGHSPAMKKLEHFSVQKVTGDGRCLFRALVKGMAYNKGTTLNQREERENADELRMAVKEAICENEGERKLYEEALIAITVDEPIKRYCQRIVRPDFWGGESELLVLSKLCKQPIIVYIPEHEHRSGGFGSGFIPIAEYGSDFRKGSSRKAVRLLYSGKNHYDLLV*