|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G18660.4 | AT | zinc finger (C3HC4-type RING finger) family protein | JGI | N/A | IEA |
| GO:0000209 | GO-bp | protein polyubiquitination | EnsemblGenomes | N/A | IEA |
| GO:0006508 | GO-bp | proteolysis | JGI | N/A | IEA |
| GO:0032436 | GO-bp | positive regulation of proteasomal ubiquitin-dependent protein catabolic process | EnsemblGenomes | N/A | IEA |
| GO:0005622 | GO-cc | intracellular | EnsemblGenomes | N/A | IEA |
| GO:0004176 | GO-mf | ATP-dependent peptidase activity | JGI | N/A | IEA |
| GO:0031624 | GO-mf | ubiquitin conjugating enzyme binding | EnsemblGenomes | N/A | IEA |
| GO:0061630 | GO-mf | ubiquitin protein ligase activity | EnsemblGenomes | N/A | IEA |
| PTHR23327 | Panther | RING FINGER PROTEIN 127 | JGI | N/A | IEA |
| PF02190 | PFAM | ATP-dependent protease La (LON) domain | JGI | N/A | IEA |
|
Glyma.03g062700 not represented in the dataset |
Glyma.03g062700 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma03g08923 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.03g062700.1 sequence-type=CDS polypeptide=Glyma.03g062700.1.p locus=Glyma.03g062700 ID=Glyma.03g062700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGAAGGCAATCATTGGATGGGAATGGCTATACTTGATTCAACGGGTTCCTTAGCTGAGTTTGCCTGTGAAGTGGAAATAACAGAGTGTGAACGACTTCCAGATGGTCATTTTTATATAAAGATTGAAAGTTGTTGGAGATTTCGTATCATCCGTTCCTGGGATCAAGATGGGTACCATGTTGCAGAGGTTGAATGGATACAAGATATATAG
>Glyma.03g062700.1.p sequence-type=predicted peptide transcript=Glyma.03g062700.1 locus=Glyma.03g062700 ID=Glyma.03g062700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MEGNHWMGMAILDSTGSLAEFACEVEITECERLPDGHFYIKIESCWRFRIIRSWDQDGYHVAEVEWIQDI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||