SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.03g062700

Feature Type:gene_model
Chromosome:Gm03
Start:9666161
stop:9668016
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.03g062700
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G18660.4AT zinc finger (C3HC4-type RING finger) family protein JGI N/AIEA
GO:0000209GO-bp protein polyubiquitination EnsemblGenomesN/AIEA
GO:0006508GO-bp proteolysis JGI N/AIEA
GO:0032436GO-bp positive regulation of proteasomal ubiquitin-dependent protein catabolic process EnsemblGenomesN/AIEA
GO:0005622GO-cc intracellular EnsemblGenomesN/AIEA
GO:0004176GO-mf ATP-dependent peptidase activity JGI N/AIEA
GO:0031624GO-mf ubiquitin conjugating enzyme binding EnsemblGenomesN/AIEA
GO:0061630GO-mf ubiquitin protein ligase activity EnsemblGenomesN/AIEA
PTHR23327Panther RING FINGER PROTEIN 127 JGI N/AIEA
PF02190PFAM ATP-dependent protease La (LON) domain JGI N/AIEA

Expression Patterns of Glyma.03g062700
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.03g062700 not represented in the dataset
Glyma.03g062700 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.03g062700 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma03g08923 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.03g062700
>Glyma.03g062700.1 sequence-type=CDS polypeptide=Glyma.03g062700.1.p locus=Glyma.03g062700 ID=Glyma.03g062700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGAAGGCAATCATTGGATGGGAATGGCTATACTTGATTCAACGGGTTCCTTAGCTGAGTTTGCCTGTGAAGTGGAAATAACAGAGTGTGAACGACTTCCAGATGGTCATTTTTATATAAAGATTGAAAGTTGTTGGAGATTTCGTATCATCCGTTCCTGGGATCAAGATGGGTACCATGTTGCAGAGGTTGAATGGATACAAGATATATAG
Predicted protein sequences of Glyma.03g062700
>Glyma.03g062700.1.p sequence-type=predicted peptide transcript=Glyma.03g062700.1 locus=Glyma.03g062700 ID=Glyma.03g062700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MEGNHWMGMAILDSTGSLAEFACEVEITECERLPDGHFYIKIESCWRFRIIRSWDQDGYHVAEVEWIQDI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo